PDF4PRO ⚡AMP

Modern search engine that looking for books and documents around the web

Example: tourism industry

SCREEN-PROTECTOR - Mobilis

Back to document page

SCREEN-PROTECTORANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPA A & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & STERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : | For more informations, visit our website : finish 180 Privacy filter Clear finish99% transparencyMatte finishAnti-fingerprintAnti-glarePackagin g for Anti-ShockComposed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardPackaging for Tempered Glass(in Polycarbonate)Composed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardTYPOLOGYANTI-SCRATCH TEMPERED GLASS 9HANTI-SHOCK IK06FINISHCLEARMATTECLEARMATTEPRIVACYCLE ARMATTEPRIVACYIK ANTI-SHOCK NORMIK02IK02IK03IK03IK03IK06IK06IK06HARD NESS4H4H9H9H9H5H5H5HBUBBLE FREE ANTI-FINGERPRINT ANTI-GLARE ABSORPTION ROUNDED CATEGORY PRIVACY FILTERSSCREEN PROTECTORSANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 |

SCREEN-PROTECTOR ANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPAÑA & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & ÖSTERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : infos@mobiliscase.com | For more …

  Mobilis

Download SCREEN-PROTECTOR - Mobilis


Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Spam in document Broken preview Other abuse

Related search queries