PDF4PRO ⚡AMP

Modern search engine that looking for books and documents around the web

Example: stock market

© Keith Briggs

SVSQSLSFSANVNQNLNFNAHVSWSRSMSGSBNWNRNMNG NBHWSXSSSNSHSCNXNSNNNHNCHXSYSTSOSJSDNYNT NONJNDHYSZSUSPSKSENZNUNPNKNEHZTVTQTLTFTA OVOQOATWTRTMTGTBOWOR10101001001011111012 1212131313131313131301301301301301311311 3113113113114141414141414140140140140141 1421421431441451461471481515151515151515 1515150150150150150150150150152153153153 153153154155155155155155155155156160a160 a160a160b160b160b160c160c160c160cc160cc1 61161a161a161a162162162163163163163a163a 163b163b16416416516516516516616616616716 7167168a168a168a168a168a168a168a168a169b 169b16a16a16a16a16a16a16b16b16b16b16b16b 17170a170a170b170b171171171172b172b173d1 73d173d173d173d173d173d173d173d173d173d1 74174175175175175a175a176176176176176177 1801801801801801801801801811811811811811 8118218218318918918a18a18a18a18b18b18b18 b18b18c18c18c18c18d18d18d18d18e18e18ee18 ee19191919191901911921921921931931931931 931931931931a1a1b1b1b1b1c1c1c1c1c1d1d1d1 e1

sv sq sl sf sa nv nq nl nf na hv sw sr sm sg sb nw nr nm ng nb hw sx ss sn sh sc nx ns nn nh nc hx sy st so sj sd ny nt no nj nd hy sz su sp sk se nz nu np nk ne hz ...

Tags:

  Briggs, Keith, Keith briggs

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Spam in document Broken preview Other abuse

Transcription of © Keith Briggs

Related search queries