Transcription of digraphs - KIZCLUB
{{id}} {{{paragraph}}}
BEGINNING DIGRAPHSENDING digraphs chcheeseshshoeththreewhwhistlephpheasant quailknknifewritechpeachshcashthteethlam bcktruckngringwatchbadgembtchdgewrqu
whistle ph pheasant quail kn knife write ch peach sh cash th teeth lamb ck truck ng ring watch badge mb tch dge qu wr. Title: digraphs Created Date: 4/17/2017 3:16:21 PM ...
Domain:
Source:
Link to this page:
Please notify us if you found a problem with this document:
{{id}} {{{paragraph}}}