Transcription of Fall Puzzle - KIZCLUB
{{id}} {{{paragraph}}}
fall PuzzleFind the All rights cpumpkinsleavesrakescarecrowwindyzleaves ppdaoucuinfwgam iseifrpnrsnkekkahdacilkwynrneewesosuassg w
Fall Puzzle Find the words. Copyright c by KIZCLUB.COM. All rights reserved. rake leaves scarecrow windy pumpkins z l e a v e s p p …
Domain:
Source:
Link to this page:
Please notify us if you found a problem with this document:
{{id}} {{{paragraph}}}