PDF4PRO ⚡AMP

Modern search engine that looking for books and documents around the web

Example: tourism industry

Proteinase K

Proteinase KFT-85870nProduct dataProteinase K, from Tritirachium album timber (Engyodontium album)Syn.: peptidase K, Tritirachium alkaline proteinaseProtein K powder #858706 Proteinase K solution #718961 CAS: [ 39450-01-6 ] MW: 8,900 daltons ( kDa). primary sequence for Proteinase K: GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVID TGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGS RTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKN NRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAA GNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVL DIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMT LGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA FAQ & Technical tipsWhat is Proteinase K?PProteinase K (also protease K or endopeptidase K) is a broad-spectrum serine protease widely used in molecular biology. Proteinase K is able to digest native keratin (hair), hence, the name Proteinase K . It is commonly used because of its broad specificity, that makes it useful to clean nucleic acid complexe samples and to lyse cells. It has been used for isolation of mRNA, high molecular weight DNA and to inactivate other enzymatic enzyme was discovered in 1974 in extracts of the fungus Engyodontium album (formerly Tritirachium album).

Alternatively, prepare a 1.25 % agar containing 2% casein in pH eight buffer and pour into a petri dish. Punch 4mm diameter wells in the gel about 20 mm apart. In the wells place various concentrations of your proteinase K solution. Allow to incubate at room temp (humidified)for 6-8 hrs. Look for the clear zones around the wells.

Loading..

Tags:

  Buffer

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Spam in document Broken preview Other abuse

Transcription of Proteinase K

Related search queries