Example: marketing

ALV APPLICATION FOR LICENSING ... - Car Licence Renewal

ALV(9)(2011/07)ALVREPUBLIC OF SOUTH AFRICAREPUBLIEK VAN SUID-AFRIKAAPPLICATION FOR LICENSINGOF MOTOR VEHICLE(National Road Traffic Act, 1996)Green/GroenAANSOEK OM LISENSI RINGVAN MOTORVOERTUIG(Nasionale Padverkeerswet, 1996)NB: If APPLICATION is made after the 22 day of the month followingndthe expiry date of the current Licence , penalties for late LICENSING willbe payable and, if APPLICATION is made in the following month orthereafter, arrear Licence fees will also be : Acceptable identification is essential (including that of theproxy or representative).

the expiry date of the current licence, penalties for late licensing will be payable and, if application is made in the following month or thereafter, arrear licence fees will also be payable. NOTE: Acceptable identification is essential (including that of the proxy or representative).

Tags:

  Licence, Fees, Licence fees

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of ALV APPLICATION FOR LICENSING ... - Car Licence Renewal

1 ALV(9)(2011/07)ALVREPUBLIC OF SOUTH AFRICAREPUBLIEK VAN SUID-AFRIKAAPPLICATION FOR LICENSINGOF MOTOR VEHICLE(National Road Traffic Act, 1996)Green/GroenAANSOEK OM LISENSI RINGVAN MOTORVOERTUIG(Nasionale Padverkeerswet, 1996)NB: If APPLICATION is made after the 22 day of the month followingndthe expiry date of the current Licence , penalties for late LICENSING willbe payable and, if APPLICATION is made in the following month orthereafter, arrear Licence fees will also be : Acceptable identification is essential (including that of theproxy or representative).

2 NB: Indien na die 22 dag van die maand wat volg op diestevervaldatum van die huidige lisensie aansoek gedoen word, is boetesvir laat lisensi ring betaalbaar en, indien aansoek gedoen word in diedaaropvolgende maand of daarna, is agterstallige lisensiegelde WEL: Aanvaarbare identifikasie is noodsaaklik (insluitend dievan die gevolmagtigde of verteenwoordiger).PARTICULARS OF OWNERBESONDERHEDE VAN EIENAARType of identification(mark with X)traffic register IDRSA IDforeign IDbuitelandse IDbusiness reg. identifikasie(merk met X)Identification numberIdentifikasienommerCountry of issueif foreign IDLand van uitreikingindien buitelandse IDSurname/Nameof organisationVan/Naam van instellingInitials and first names(not more than 3)-Voorletters en voorname(hoogstens 3)(initials/voorletters)(first names/voorname)E-mail addressE-pos adresTelephone number at home-Telefoonnommer by woning(code/kode)(number/nommer)Contact telephone numberduring day-Kontaktelefoonnommerbedags(code/kode )(number/nommer)Facsimile number-Faksimileenommer(code/kode)

3 (number/nommer)Cellphone numberSelfoonnommerPostal addressPosadresSuburbVoorstadCity/TownSt ad/Dorp(postal code/poskode)Street addressStraatadresSuburbVoorstadCity/Tow nStad/Dorp(postal code/poskode)Address where noticesmust be served(mark with X)postal addressposadresstreet addressstraatadresAdres waar kennisgewingsbeteken moet word(merk met X)ORGANISATION'S PROXYINSTELLING SE GEVOLMAGTIGDEType of identification(mark with X)traffic register IDRSA IDforeign IDbuitelandse IDSoort identifikasie(merk met X)Identification numberIdentifikasienommerCountry of issueif foreign IDLand van uitreikingindien buitelandse IDSurname andinitialsanden Van envoorlettersTURN OVERBLAAI OMORGANISATION'S REPRESENTATIVEINSTELLING SE VERTEENWOORDIGERType of identification(mark with X)traffic register IDRSA IDforeign IDbuitelandse IDSoort identifikasie(merk met X)

4 Identification numberIdentifikasienommerCountry of issueif foreign IDLand van uitreikingindien buitelandse IDSurname andinitialsanden Van envoorlettersIDENTIFICATION OF MOTOR VEHICLEIDENTIFIKASIE VAN MOTORVOERTUIGL icence numberLisensienommerVehicle register number(if available)Voertuigregisternommer(indien beskikbaar)Chassis number/VINO nderstelnommer/VINMakeFabrikaatSeries name(describe in full)Reeksnaam(beskryf volledig)Odometer reading(if available)no odometergeen odometerorofkmhour/uurOdometer-lesing(in dien beskikbaar)Position of steering wheel(mark with X)drawngesleepleftlinkscentremiddelright regsPosisie van stuurwiel(merk met X)DECLARATIONVERKLARINGI, theEk, dieownereienaarorganisation's proxyinstelling se gevolmagtigdeorganisation's representativeinstelling se verteenwoordiger(a) declare that all the particularsfurnished by me in this form aretrue and correct; and(b) realise that a false declaration ispunishable with a fine orimprisonment or both.

5 (a) verklaar dat alle besonderhedewat deur my op hierdie vormverstrek is, waar en korrek is; en(b) besef dat 'n vals verklaringstrafbaar is met 'n boete ofgevangenisstraf of .. HandtekeningPlace ..PlekDate2:0:::DatumY/JMDFOR OFFICE USE ONLYNET VIR KANTOORGEBRUIKDate of APPLICATION (effective date)2:0:::Datum van aansoek(effektiewe datum)Y/JMDName and signatureof counter officialNaam en handtekeningvan toonbankbeampteName/NaamSignature/Handte keningDate/DatumName and signatureof data capturing officialNaam en handtekeningvan datavasleggingsbeampteName/NaamSignature /HandtekeningDate/DatumSerial number (bottom right-hand corner)of vehicle Licence issuedReeksnommer (onder regterkantste hoek)van motorvoertuiglisensie uitgereik


Related search queries