Example: stock market

Base Cabinets - American Woodmark

WALL CABINETS111 BASE CABINETSD esigner Resources: American Woodmark Designer s Choice Specification GuideBase CabinetsDimensions Width Height Depth 6 to 48 341 2 24 (Reduced Depth optional on select Cabinets )SKU Coding B 30 BUTT Cabinet Type Width in Inches Cabinet Type ( , B=Base)Construction Options & ModificationsAPC ..All Plywood Construction CFO ..Cabinet Front OnlyFE ..Furniture EndsIF ..Inverted FramePE ..Plywood EndsRD ..Reduced DepthRTK ..Recessed Toe KickVTD ..Void Top DrawerBASE CABINETS112 Standard Base CabinetsStandard Base Cabinets are 34 1 2 high by 24 deep and range from 12 to 48 door Standard Base Cabinets are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick must be ordered separately.

Kit in natural finish solid wood features chrome rails Full-depth adjustable shelf must be field trimmed to half-depth Cannot be used with Deep Roll Out Trays Solid wood cutting board is NOT dishwasher safe Cutting board measures 15 15⁄ 16″ x 10 9⁄ 16″ x 1 3⁄ 16″ Base Cabinet 1 Door, 1 Drawer With Cutting Board Door Rack Kit B18 CBDR

Tags:

  American, Woods

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of Base Cabinets - American Woodmark

1 WALL CABINETS111 BASE CABINETSD esigner Resources: American Woodmark Designer s Choice Specification GuideBase CabinetsDimensions Width Height Depth 6 to 48 341 2 24 (Reduced Depth optional on select Cabinets )SKU Coding B 30 BUTT Cabinet Type Width in Inches Cabinet Type ( , B=Base)Construction Options & ModificationsAPC ..All Plywood Construction CFO ..Cabinet Front OnlyFE ..Furniture EndsIF ..Inverted FramePE ..Plywood EndsRD ..Reduced DepthRTK ..Recessed Toe KickVTD ..Void Top DrawerBASE CABINETS112 Standard Base CabinetsStandard Base Cabinets are 34 1 2 high by 24 deep and range from 12 to 48 door Standard Base Cabinets are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick must be ordered separately.

2 Full-depth adjustable shelfBase Cabinet1 Door, 1 DrawerAPCCFOFEIFPERDRTKB12B15B18B21B24B2 4 BUTTB27 BUTTB30 BUTTB33 BUTTB36 1TD BUTT Full-depth adjustable shelf Center support for shelf providedBase Cabinet2 Butt Doors, 1 DrawerAPCCFOFEIFPERDRTKB36B39B42B48 Full-depth adjustable shelf Center support for shelf providedBase Cabinet2 Doors, 2 DrawersAPCCFOFEIFPERDRTK Full-depth adjustable shelf Center support for shelf provided Hinged as shown center door can be reversed in the field Shelf must be installed through top of cabinet and cannot be removed through door openingBase Cabinet3 Doors, 3 DrawersB45 APCCFOFEIFPERDRTKC onstruction Options (see page 51): = Available for selected SKUsBASE Cabinets : StandardBASE CABINETS113 Base Cabinets with AccessoriesBase Cabinets with accessories are 341 2 high by 24 deep and range from 12 to 48 door Base Cabinets with accessories are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick - must be ordered FWTB15 FWTB18 FWTB21 FWTB24 FWT Deep Roll Out Tray (DROT) on floor Full-depth adjustable shelf in center position Deep Roll Out Tray is not adjustableBase Cabinet1 Door, 1 Drawer1 Deep Roll Out TrayFACTORYINSTALLEDAPCFEPERDRTKVTDB24 FWT BUTTB27 FWT BUTTB30 FWT BUTTB33 FWT BUTTB36 1TD FWT BUTT Deep Roll Out Tray (DROT)

3 On floor Full-depth adjustable shelf in center position Deep Roll Out Tray is not adjustableBase Cabinet2 Butt Doors, 1 Drawer1 Deep Roll Out TrayFACTORYINSTALLEDAPCFEPERDRTKVTDB36 2TB39 2TB42 2TB48 2T Deep Roll Out Tray (DROT) on floor in each door opening Full-depth adjustable shelf in center position Deep Roll Out Trays are not adjustableBase Cabinet2 Doors, 2 Drawers2 Deep Roll Out TraysFACTORYINSTALLEDAPCFEPERDRTKVTDB45 3T Deep Roll Out Tray (DROT) on floor in each door opening Full-depth adjustable shelf in center position Deep Roll Out Trays are not adjustable Hinged as shown center door can be reversed in the field Shelf must be installed through top of cabinet and cannot be removed through door openingBase Cabinet3 Doors, 3 Drawers3 Deep Roll Out TraysFACTORYINSTALLEDAPCFEPERDRTKVTDD esigner Resources: American Woodmark Designer s Choice Specification GuideBASE Cabinets .

4 With AccessoriesBASE CABINETS114B12 2 FWTB15 2 FWTB18 2 FWTB21 2 FWTB24 2 FWT Two Deep Roll Out Trays (DROT) Deep Roll Out Trays are not adjustableBase Cabinet1 Door, 1 Drawer2 Deep Roll Out TraysFACTORYINSTALLEDAPCFEPERDRTKVTDB24 2 FWT BUTTB27 2 FWT BUTTB30 2 FWT BUTTB33 2 FWT BUTTB36 1TD 2 FWT BUTT Two Deep Roll Out Trays (DROT) Deep Roll Out Trays are not adjustableBase Cabinet2 Butt Doors, 1 Drawer2 Deep Roll Out TraysFACTORYINSTALLEDAPCFEPERDRTKVTDFACT ORYINSTALLEDBase Cabinet3 Doors, 3 Drawers6 Deep Roll Out TraysB45 6T Two Deep Roll Out Trays (DROT) in each door opening Deep Roll Out Trays are not adjustable Hinged as shown center door can be reversed in the fieldAPCFEPERDRTKVTDB36 4TB39 4TB42 4TB48 4T Two Deep Roll Out Trays (DROT) in each door opening Deep Roll Out Trays are not adjustableBase Cabinet2 Doors, 2 Drawers4 Deep Roll Out TraysFACTORYINSTALLEDAPCFEPERDRTKVTDB24 BUTT BPPOB27 BUTT BPPOB30 BUTT BPPOB33 BUTT BPPOB36 1TD BUTT BPPOAPCFEIFPERTKVTD Organizer in natural finish solid wood and wood veneer with engineered wood bottom Front of organizer features dovetail construction Top shelf measures 6 3 16 deep Middle shelf measures 9 3 4 deepBase Pot & Pan Organizer Cabinet2 Butt Doors, 1 DrawerFACTORYINSTALLEDB24 BPPO Organizer in natural finish solid wood and wood veneer with engineered wood bottom Front of organizer features dovetail construction Top shelf measures 6 3 16 deep Middle shelf measures 9 3 4 deepBase Pot & Pan Organizer Cabinet1 Door, 1 DrawerFACTORYINSTALLEDAPCFEIFPERTKVTDC onstruction Options (see page 51).

5 = Available for selected SKUsBASE Cabinets : With AccessoriesBASE CABINETS115 Roll Out Tray Divider in natural finish solid wood and wood veneer construction No shelf B12 ROTD features two compartments (one partition) B15 ROTD features three compartments (two partitions) Partition(s) are field installed Base CabinetWith Factory Installed Roll Out Tray DividerFACTORYINSTALLEDAPCFEPERTKB12 ROTDB15 ROTD Plastic Bag Door Storage Unit packaged separately for field installation Unit in natural finish solid wood and wood veneer Full-depth adjustable shelf must be field trimmed to half-depth Cannot be used with Deep Roll Out Trays Removable white plastic tray is NOT dishwasher safeBase Cabinet1 Door, 1 DrawerWith Plastic Bag Door Storage KitB15 PBDSUB18 PBDSUAPCFEPERTK Cutting Board Door Rack Kit packaged separately for field installation Kit in natural finish solid wood features chrome rails Full-depth adjustable shelf must be field trimmed to half-depth Cannot be used with Deep Roll Out Trays Solid wood cutting board is NOT dishwasher safe Cutting board measures 15 15 16 x 10 9 16 x 1 3 16 Base Cabinet1 Door.

6 1 DrawerWith Cutting Board Door Rack KitB18 CBDRAPCFEPERTKBWBB15 BWBB15-2 BWBB18-2 BWBB21-2 APCFEIFPERTKBase Cabinet1 Door, 1 Drawer1 Bottom Mount WastebasketFACTORYINSTALLEDBase Cabinet1 Door, 1 Drawer2 Bottom Mount WastebasketsFACTORYINSTALLEDAPCFEIFPERTK Features one silver plastic 35-quart capacity bin Wastebasket rests in a natural finish wood frame Features heavy-duty 132-pound rated glides Decorative hardware strongly recommended Features two silver plastic bins: BWBB15-2 is 27-quart capacity BWBB18-2 and BWBB21-2 are 35-quart capacity Wastebaskets rest in a natural finish wood frame Features heavy-duty 132-pound rated glides Decorative hardware strongly recommendedDesigner Resources: American Woodmark Designer s Choice Specification GuideBASE Cabinets : With AccessoriesBASE CABINETS116 Full-Height Base CabinetsFull-Height Base Cabinets are 341 2 high by 24 deep and range from 9 to 36 wide.

7 Single door Full-Height Base Cabinets are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick - must be ordered separately. No shelf Full-height door For vertical tray storage Order S924 adjustable shelf separately Not available with Recessed Toe Kick Both (RTKB) OptionFull-Height Base Cabinet1 Door, No ShelfAPCCFOFEPERDRTKTB9 APCCFOFEPERDRTKB12 FHB15 FHB18 FHB21 FHAPCCFOFEPERDRTKB24 BUTT FHB30 BUTT FHB36 BUTT FHFull-Height Base Cabinet1 Door, 1 Adjustable Shelf Full-depth adjustable shelf Full-height door Full-depth adjustable shelf Full-height doorsFull-Height Base Cabinet2 Butt Doors, 1 Adjustable ShelfConstruction Options (see page 51): = Available for selected SKUsBASE Cabinets : Full-HeightBASE CABINETS117 Full-Height Base Cabinetswith AccessoriesFull-Height Base Cabinets with accessories are 34 1 2 high by 24 deep and range from 9 to 30 wide.

8 Single door Full-Height Base Cabinets are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick - must be ordered Pantry Pull Out Full-height door One fixed bottom and three adjustable shelves in natural finish with chrome rails Decorative hardware strongly recommended BPP9 not available with Recessed Toe Kick Both (RTKB) OptionFACTORYINSTALLEDAPCFEPERTKBTDP9 Full-height door One fixed bottom shelf in natural finish with an adjustable chrome tray divider One adjustable chrome T-Bar included for storage customization Decorative hardware strongly recommended Not available with Recessed Toe Kick Both (RTKB) OptionBase Tray Divider Pull OutAPCFEPERTKFACTORYINSTALLEDBPP9 BPP12 ABPP9 9 BPP12 12 Full-height door Full-depth adjustable shelf TD3 Cabinet Tray Divider packaged separately for field installation Only available with RD-23 through RD-14 Not available with Recessed Toe Kick Both (RTKB) OptionFull-Height Base Cabinet1 Door with Tray Divider and ShelfAPCFEPERDRTKTB9 TDSBASE Cabinets .

9 Full-Height with AccessoriesBase Pantry Pull Out Utensil Storage Full-height door One fixed bottom and one adjustable lower shelf in natural finish with chrome rails One fixed upper shelf in natural finish with chrome rails and three stainless steel removable storage bins Stainless steel bins measure 5 1 4 wide by 6 7 8 deep Decorative hardware strongly recommended BPPUS9 not available with Recessed Toe Kick Both (RTKB) OptionAPCFEPERTKBPPUS9 BPPUS12 ABPPUS9 9 BPPUS12 12 FACTORYINSTALLEDD esigner Resources: American Woodmark Designer s Choice Specification GuideABASE CABINETS118 FACTORYINSTALLEDB18 FH 2 FWTFull-Height Base Cabinet 1 Door, 2 Deep Roll Out Trays Full-height door Two Deep Roll Out Trays (DROT)APCFEPERDRTKAPCFEPERDRTKB24 BUTT FH 2 FWTB30 BUTT FH 2 FWT Full-Height Base Cabinet2 Butt Doors, 2 Deep Roll Out Trays Full-height doors Two Deep Roll Out Trays (DROT)FACTORYINSTALLEDB18 FH 4 FWTFull-Height Base Cabinet1 Door, 4 Deep Roll Out Trays Full-height door Four Deep Roll Out Trays (DROT)APCFEPERDRTKFACTORYINSTALLEDB24 BUTT FH 4 FWTB30 BUTT FH 4 FWTFull-Height Base Cabinet2 Butt Doors, 4 Deep Roll Out Trays Full-height doors Four Deep Roll Out Trays (DROT)

10 APCFEPERDRTKFACTORYINSTALLEDBWBB15 FH BWBB18 FH Full-Height Base Cabinet1 Bottom Mount WastebasketAPCFEPERTKFACTORYINSTALLEDBWB B21-2 FH Full-Height Base Cabinet2 Bottom Mount WastebasketsAPCFEPERTKFACTORYINSTALLEDBA SE Cabinets : Full-Height with Accessories Full-height door Features one silver plastic 50-quart capacity bin Wastebasket rests in a natural finish wood frame Features heavy-duty 132-pound rated glides Decorative hardware strongly recommended Full-height door Features two silver plastic 50-quart capacity bins Wastebaskets rest in a natural finish wood frame Features heavy-duty 132-pound rated glides Decorative hardware strongly recommendedConstruction Options (see page 51): = Available for selected SKUsBASE CABINETS119 Sink/Cooktop Base Cabinets are 341 2 high x 24 deep and range from 18 to 48 door Sink/Cooktop Base Cabinets are hinged left and can be reversed in the Toe Kick construction requires BTK8 matching toe kick must be ordered Base CabinetsWhen placing a Sink/Cooktop Base cabinet in a design, select a cabinet at least 3 wider than the sink or cooktop to allow for installation clips.


Related search queries