Example: quiz answers

FESCANT PLUS CANT STRIP TAPERED FESCOEDGE STRIP

Energy and the EnvironmentLEED Recycled ContentCant STRIP : 37% average Edge STRIP : 33% averageFor post and pre-consumer recycled content percentages, visit the FESCO Board product page on the JM roofing Web plus Cant STRIP contains an average of 37% recycled content. TAPERED Fesco Edge STRIP contains an average of 33% recycled content. Peak Advantage Guarantee InformationSystemsGuarantee Term*When used in most JM multi-ply or single ply ,15 or 20 years* Contact JM Technical Services for specific systems or terms over 20 and Approvals Expanded Perlite ReinforcingCellulosic Fibers Selected BindersInstallation/ApplicationMechanica llyFastenedUrethaneAdhesiveHot AsphaltCold AppliedRefer to the Application Guides and Detail Drawings for

FESCANT PLUS CANT STRIP TAPERED FESCO ® EDGE STRIP Perlite-Based Specialty Accessory Product Typical Physical Properties* Test ASTM FesCant Plus Cant Strip* Tapered FESCO Edge Strip*

Tags:

  Plus, Strips, Tapered, Reptiles, Ncat, Fescant plus cant strip tapered, Fescant

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of FESCANT PLUS CANT STRIP TAPERED FESCOEDGE STRIP

1 Energy and the EnvironmentLEED Recycled ContentCant STRIP : 37% average Edge STRIP : 33% averageFor post and pre-consumer recycled content percentages, visit the FESCO Board product page on the JM roofing Web plus Cant STRIP contains an average of 37% recycled content. TAPERED Fesco Edge STRIP contains an average of 33% recycled content. Peak Advantage Guarantee InformationSystemsGuarantee Term*When used in most JM multi-ply or single ply ,15 or 20 years* Contact JM Technical Services for specific systems or terms over 20 and Approvals Expanded Perlite ReinforcingCellulosic Fibers Selected BindersInstallation/ApplicationMechanica llyFastenedUrethaneAdhesiveHot AsphaltCold AppliedRefer to the Application Guides and Detail Drawings for and DimensionsProductFesCant plus Cant StripSizes1" x 3"1" x 4" " x 4" " x 5" strips /Bundle33213018 Bundles/Pallet30302020 Linear Ft/Bundle1208412072Lb/Bundle20203030 Pallet Weight (lb)

2 600 Pallets/Truck*48 ProductTapered FESCO Edge " x 6" " x 12"1" x 12"1" x 18" " x 12" " x 18" strips /Bundle723628181212 Bundles/Pallet141410101610 Linear Ft/Bundle288144112724848 BFT/Bundle363656543654Lb/Bundle603593506 060 Pallet Weight840490933500960600 Pallets/Truck*48 Producing LocationRockdale, IL*Assumes 4 8' flatbed plus CANT STRIP TAPERED FESCO EDGE STRIPP erlite-Based Specialty Accessory ProductRS-5049 8-16 (Replaces 6-15)Features and ComponentsExpanded Perlite: Provides good dimensional stability and excellent insulation value with stable R-value.

3 The high perlite content offers far greater fire resistance than conventional wood fiber Cellulosic Fibers: Consists of recycled newsprint to provide strength to the board as well as high recycled content. JM utilizes third party certification by UL Environment to certify the recycled content and contributes to the LEED Materials and Resource (MR) credit plus Cant strips : Manufactured from JM Cant Board, a high-density, laminated perlite board that provides excellent transition from the deck to the wall of the FESCO Edge strips .

4 Excellent for transitioning from membrane to nailer, or transitioning from TAPERED FESCO , TAPERED ENRGY 3 , or TAPERED Fesco Foam panels to the roof level to help promote positive Compatibility This product may be used as a component in the following systems. Please reference product application for specific installation methods and information. Multi-PlyBURAPPSBSS ingle PlyTPOPVCEPDMHACACAHWHACAHWSAMFFAMFFAMFF ABAC ompatible with the selected Multi-Ply systems aboveDo not use in Single Ply systemsKey: HA = Hot Applied CA = Cold Applied HW = Heat Weldable SA = Self Adhered MF = Mechanically Fastened FA = Fully Adhered BA = BallastedComponentTypePL PerliteLT Low ThermalB Cover BoardMulti-PlyRefer to the Safety Data Sheet and product label prior to using this product.

5 The Safety Data Sheet is available by calling (800) 922-5922 or on the Web at plus CANT STRIP TAPERED FESCO EDGE STRIPP erlite-Based Specialty Accessory ProductTypical Physical Properties* TestASTMFesCant plus Cant STRIP * TAPERED FESCO Edge STRIP *StrengthProduct Density, pcf (kg/m3), minC 20910 (160)8 (128)Compressive Strength 5% Consolidation, psi (kPa), nomC 165 35 (241)30 (207)Laminar Tensile Strength, psi (kPa), nomC 20911 (76)8 (55)Flexural Strength, psi (kPa), minC 20360 (414)40 (276)MoistureWater Absorption, % by vol, maxC Expansion, %, maxC * FESCANT plus Cant STRIP meets the requirements of ASTM C 728, Type 2, TAPERED FESCO Edge STRIP meets the requirements of ASTM C 728, Type PerformanceTestASTMFesCant plus Cant StripTapered FESCO Edge StripFlame SpreadE 843525 Smoke DevelopedE 841010RS-5049 8-16 (Replaces 6-15)Refer to the Safety Data Sheet and product label prior to using this product.

6 The Safety Data Sheet is available by calling (800) 922-5922 or on the Web at