Example: stock market

Fun Beginning Puzzles for Kids Book 1 - …

SudokuCrosswordWord SearchCrossnumbersNumber SearchAges 4-8 FunBeginningPuzzlesfor KidsBook 1by Noah Ealyw/Michael Ealy1 Fun Beginning Puzzles for KidsCrosswordWord and Number SearchSudokuAges 4-8byNoah Ealywith Michael EalyBNG Publishing, , Florida2 ContentsIntroduction .. 3 Number Search ..4 Word Search ..26 crossword ..48 Number crossword ..68 Sudoku ..88 Answers ..110 Fun Beginning Puzzles for kids , book 1: crossword , Word and Number Search, SudokuPublished by BNG Publishing 2008 All rights reserved, including the right ofreproduction in whole or in part in any ISBN-13: 978-0-9797882-0-8 ISBN: 0-9797882-0-XFirst Edition10 9 8 7 6 5 4 3 2 13 IntroductionFun Beginning Puzzles for kids , book 1 is the perfectpuzzle book to get kids interested in working popularpuzzles. Besides being fun, Puzzles help to improvemath skills, vocabulary, fine motor skills, patienceand Puzzles in this book are not designed to bedifficult.

Sudoku Crossword Word Search Crossnumbers Number Search Ages 4-8 Fun Beginning Puzzles for Kids Book 1 by Noah Ealy w/Michael Ealy

Tags:

  Beginning, Book, Puzzles, Crossword, Kids, Fun beginning puzzles for kids book

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of Fun Beginning Puzzles for Kids Book 1 - …

1 SudokuCrosswordWord SearchCrossnumbersNumber SearchAges 4-8 FunBeginningPuzzlesfor KidsBook 1by Noah Ealyw/Michael Ealy1 Fun Beginning Puzzles for KidsCrosswordWord and Number SearchSudokuAges 4-8byNoah Ealywith Michael EalyBNG Publishing, , Florida2 ContentsIntroduction .. 3 Number Search ..4 Word Search ..26 crossword ..48 Number crossword ..68 Sudoku ..88 Answers ..110 Fun Beginning Puzzles for kids , book 1: crossword , Word and Number Search, SudokuPublished by BNG Publishing 2008 All rights reserved, including the right ofreproduction in whole or in part in any ISBN-13: 978-0-9797882-0-8 ISBN: 0-9797882-0-XFirst Edition10 9 8 7 6 5 4 3 2 13 IntroductionFun Beginning Puzzles for kids , book 1 is the perfectpuzzle book to get kids interested in working popularpuzzles. Besides being fun, Puzzles help to improvemath skills, vocabulary, fine motor skills, patienceand Puzzles in this book are not designed to bedifficult.

2 Older children should be able to read andsolve most Puzzles without difficulty, while youngerchildren may need the assistance of an adult to readand write in answers. Regardless of age thesebeginning Puzzles will instill a sense of achievementwhen confirms the benefits of reading andplaying with young children. These Puzzles aredesigned to provide another source of fun,meaningful, educational the Authors andAcknowledgementsNoah and Michael Ealy are a father and son teamwho, in addition to other wide and varied interests,enjoy creating and solving Puzzles would like to thank the following people, in noparticular order, for their suggestions and Ealy, Alex and Haley Young, Lisa Daniel,Grandma Joyce, Grandpa Ray and Yia Yia, PappaJerry and Grandma To Play Number SearchFind the numbers hidden in the grid. When you finda number, draw a circle around it. All answers arelisted either down or across. None of the answers canbe found in reverse order or PuzzleIn the practice puzzle shown on the right, you aregiven a partially completed puzzle.

3 The first fournumbers have been found, circled, and marked off(632, 276, 821, 937). The next two numbers have beenfound but only partially circled and marked off (485and 253). The last two numbers have not been foundyet (928 and 203). Compete this puzzle by finding,circling and marking off the remaining you complete the puzzle, you can check yoursolution by turning to page fun!5 Number Search - Practice Puzzle6328490252032337677592876829234850 166324852762538219289372036 Number Search - Puzzle 1272606854221068750157253086931365138542 260801553869756610365 The solution to thispuzzle is on page Search - Puzzle 2972907753272018759167979086931165489970 751797876991757165290 The solution to thispuzzle is on page Search - Puzzle 3192728996251248250751875551578235708994 810996228518272570551 The solution to thispuzzle is on page Search - Puzzle 1813542785590786846325431765397890535677 2386314354590796578462214355679793463109 4537653278551916464545997895756610831099 79392975748907835568756 The solution to thispuzzle is on page Search - Puzzle 1984653289670456218857493356448868574297 0688531425478973232564873529829191828483 5338465876275498643598145627068480533138 48393353256425828965742 The solution to thispuzzle is on page Search - Puzzle 1425 Number Search - Puzzle

4 2082356478453126470586383619480695367318 6943768493326484326639525484151194759042 6583845823511948638265897689437470566354 51633264347608926638069 The solution to thispuzzle is on page to Play Word SearchWord search is very similar to number search. Theonly difference is you are looking for words instead ofnumbers. Each puzzle has a theme. Some concentrateon short or long vowel sounds, while others include alist of words with a similar Beginning blend as in the number search puzzle, all answers arelisted either down or across. None of the answers canbe found in reverse order or PuzzleIn the practice puzzle shown on the right, you aregiven a partially completed puzzle. The first fourwords have been found, circled, and marked off (BAT,PAT, SAT, and TAX). The next two words have beenfound but only partially circled and marked off (DADand MAN). The last two words have not been foundyet (JAM and ACT). Compete this puzzle by finding,circling and marking off the remaining you complete the puzzle, you can check yoursolution by turning to page fun!

5 27 Word Search - Practice PuzzleACTWMQVSATAJNJXZNABRECOMA IADADTYPATKBATDADPATMANSATJAMTAXACTW ords in this puzzle have the short a vowel Search - Puzzle 1 CATGMRABAZQAPBGMATKTWOBPTAPNAMAHA MGICATTAGHAMMATRATCAPBAGTAPW ords in this puzzle have the short a vowel solution to thispuzzle is on page Search - Puzzle 2 AEGGRPMJNPLEEN IWSTNTYPEGBEDEMEXNQPYTEGGMENTENPEGPETPEP BEDGETW ords in this puzzle have the short e vowel solution to thispuzzle is on page Search - Puzzle 3 TOUBI BIPIGWLPHI NKIJSKMDQAFIXINLIDVGUPIGINKBIBTIPFIXKIDD IGLIDW ords in this puzzle have the short i vowel solution to thispuzzle is on page Search - Puzzle 18 RBI TEYQKIOHS I T EZ I RXLLMGBNTLFINEMJLEYIQZSIXIGDVHNBCDKN IEWI DEAETNUQLGSHLXENI NEXP I NEMICENINELIKEPINESITEWIDEDINETIMEFINEKI TEBITEFIVEW ords in this puzzle have the long i vowel solution to thispuzzle is on page Search - Puzzle 19 GSVXFPBSLHOMEGCONEZMROPENQZNOSEOSEVSOXQP L WQOHTVHFECMTGELUOHOLEFROBEWHOPEQFX I COPEAROPECONENOSEHOLEHOMEVOTECOPEHOPENOT EROBEBONEPOLEW ords in this puzzle have the long o vowel solution to thispuzzle is on page Search - Puzzle 20 RDZTVTUBEQUJUNERYOKNHNYCVBXOEQEDUKEQMULE KBRCRRF MZ MEDXUVFUSEKPFLCUTEDHUGEXBEFVMROPJUNERULE MUTETUBETUNEDUNEDUKEFUSECUTEHUGEMULECUBE W ords in this puzzle have the long u vowel solution to thispuzzle is on page Puzzle InstructionsBesides being great fun, crosswords are an excellentway to build vocabulary and improve goal is to use the ACROSS and DOWN clues to complete the empty first square of each entry contains anumber.

6 This number corresponds to thenumber in the ACROSS or DOWN clue the partially completed squares to assist insolving other PuzzleIn the practice puzzle shown on the right, you aregiven a partially completed crossword puzzle. Theanswer to 1 ACROSS has already been completed. BIRD is the answer to the clue, An animal thatflies. Numbers 2, 3, and 4 DOWN have also beenanswered and entered into the the remaining clues to complete the you are finished or if you get stuck, you cancheck your solution on page fun!49 crossword - Practice PuzzleACROSS1. An animal that flies5. You make a sandwich with two pieces of this7. You breathe this9. Chickens lay these10. The number before twoDOWN2. Frozen water3. Another word for father4. You serve it at birthday parties6. The opposite of left8. Tomatoes are this color12345678910 CAKEBIRDCEAD50 crossword - Puzzle 1123456789 ACROSS1. You sleep in this2. An animal that barks3. Nemo is one6. This animal says meow 8.

7 Something that you read9. The number after sevenDOWN1. The opposite of small2. An animal that says quack 4. You wear this on your head5. An animal that says moo 7. The number of toes you haveThe solution to thispuzzle is on page - Puzzle 2 ACROSS2. Number of states in the United States5. The colors of the American flag are red, white, and _____6. This color traffic light means go8. _____ the Explorer (TV character)11. Use this to talk and eat withDOWN1. Put this on your foot2. The number after four3. The color of Big Bird4. What a puppy becomes7. Number of legs a spider has9. Rain, rain, go ____10. He is the king of the jungleThe solutionto this puzzleis on page - Puzzle 3 ACROSS1. Musical instrument with black and white keys you play with your hands4. Points of light in the night sky5. Third planet from the sun7. Snow White & the _____ Dwarfs9. Family member10. When you move to musicDOWN1. Clothes you wear over your legs2. Very large mammal that lives in the ocean3.

8 You smell with this6. Top of the house7. What a plant develops from8. The number after eight12345678910 The solutionto this puzzleis on page - Puzzle 12 ACROSS2. The opposite of remember4. The day before Tuesday5. A sticky strip for holding things together7. Part of the body where food is digested9. The number of toes on both feet10. There are twelve months in a ____12. You wear this to protect your head14. You do this before swallowing19. A part of a fish20. The part of your body that has fingers21. A soft floor covering22. The opposite of begin23. Hickory Dickory Dock, The Mouse Ran Up the ____DOWN1. The month before June3. Halloween is in this month4. Working with numbers6. A nice word to use when you ask for something8. The shape of a coin11. An animal that has big ears and a trunk12. Very, very big13. The sixteenth president Abraham _____ , alsoon the penny15. The first president s last name, George_____16. Use this to carry school supplies and personalitems17.

9 The opposite of on18. The short form of rhinoceros67 The solution to thispuzzle is on page 1112131415161718192021222368 Crossnumber Puzzle InstructionsCrossnumber Puzzles are very similar to only difference is the clues and answers goal is to use the ACROSS and DOWN clues to complete the grid of empty first square of each entry contains anumber. This number corresponds to thenumber in the ACROSS or DOWN clue the partially completed squares to assist insolving other PuzzleIn the practice puzzle shown on the right, you aregiven a partially completed crossnumber puzzle. Theanswer to 3 ACROSS has already been completed. 380 is the answer to the clue Three hundred andeighty. Numbers 1, 2, 3, and 4 DOWN have also beenanswered and entered into the the partially completed grid to complete the restof the puzzle. When you are finished, or if you getstuck, you can check your solution on page fun!69 Crossnumber - Practice Puzzle12345678 ACROSS3.

10 Three hundred and eighty5. One hundred and ten7. 50 + 508. 1000 + 1000 DOWN1. 20 + 102. 7000 + 1003. Three thousand four hundred4. Fifty-one6. Twelve7. 5 + 5303871004005170 Crossnumber - Puzzle 1 ACROSS2. Forty-eight4. One hundred and three6. Seventeen7. Two thousandDOWN1. 5 + 5 + 5 + 53. 8000 + 300 + 104. 8 + 85. Three hundred and eighty7. 7 + 7 + 7 The solution to thispuzzle is on page - Puzzle 2 ACROSS1. 80 + 54. 300 + 3005. Eighty6. 25 + 25 + 25 + 257. 9000 + 276 DOWN2. Five hundred and sixty3. Three thousand5. Eighty-one6. 100 + 228. 30 + 30 The solution to thispuzzle is on page - Puzzle 3 ACROSS1. 200 + 54. One thousand and one7. Six hundred and thirty-three8. 2000 + 200 + 0 + 1 DOWN2. Five hundred and thirty3. 12 + 12 + 124. One hundred and thirty-four5. 3 + 3 + 3 + 36. 10 + 10 + 109. 5 + 5 + 5 + 510. FourteenThe solution to thispuzzle is on page - Puzzle 11 ACROSS1. 10000 + 900 + 80 + 24. 2 + 2 + 2 + 2 + 2 + 2 + 2 + 25. 24 - 36. 2 x 67.


Related search queries