Example: stock market

Of Mice and Men - Puzzle Pack - Sampler PDF

No. 304387 Puzzle pack : Of Mice and MenPrinted in the division Box 658 Clayton, DE 199381 (800) pack puzzles , Games, and WorksheetsPuzzle pack puzzles , Games, and WorksheetsOf Mice and MenOf Mice and MenPuzzle pack : Of Mice And MenTeacher s Pet Publications, 2007 All Rights ReservedClick here to learn more about this Puzzle pack ! Click here to find more Classroom Resources for this title! SamplePuzzle pack LiteratureLiterary Touchstone ClassicsLiterature Teaching UnitsGrammar and WritingCollege and Career Readiness: WritingGrammar for WritingVocabularyVocabulary Power PlusVocabulary from Latin and Greek RootsReadingReading Informational TextsReading LiteratureMore from Prestwick HouseTEACHER S PET PUBLICATIONSPUZZLE pack forOf Mice and Menbased on the book byJohn SteinbeckWritten byWilliam T. Collins 2005 Teacher s Pet PublicationsAll Rights ReservedISBN 978-1-58337-675-1 Item No.

Of Mice and Men Fill In The Blanks 1 1. Town George and Lennie had to leave. 2. Stable man 3. He is mentally slow but physically strong. 4. Lennie was accused of this in Weed.

Tags:

  Pack, Puzzles, Sampler, Cime, Of mice and men, Of mice and men puzzle pack sampler pdf

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of Of Mice and Men - Puzzle Pack - Sampler PDF

1 No. 304387 Puzzle pack : Of Mice and MenPrinted in the division Box 658 Clayton, DE 199381 (800) pack puzzles , Games, and WorksheetsPuzzle pack puzzles , Games, and WorksheetsOf Mice and MenOf Mice and MenPuzzle pack : Of Mice And MenTeacher s Pet Publications, 2007 All Rights ReservedClick here to learn more about this Puzzle pack ! Click here to find more Classroom Resources for this title! SamplePuzzle pack LiteratureLiterary Touchstone ClassicsLiterature Teaching UnitsGrammar and WritingCollege and Career Readiness: WritingGrammar for WritingVocabularyVocabulary Power PlusVocabulary from Latin and Greek RootsReadingReading Informational TextsReading LiteratureMore from Prestwick HouseTEACHER S PET PUBLICATIONSPUZZLE pack forOf Mice and Menbased on the book byJohn SteinbeckWritten byWilliam T. Collins 2005 Teacher s Pet PublicationsAll Rights ReservedISBN 978-1-58337-675-1 Item No.

2 304958Of Mice and Men Word done a ___ thing. I done another ___ thing. to keep animals and store hay had 4 cans of these to eat; Lennie liked ketchup on his for a ranch hand's bedroll in charge hand's bed place ranchers stay overnight swamper whose dog was killed Candy's offers to go away and live in 's aunt who gave him always ____s about son of the ranch Curley likes to often did this; didn't and Lennie, for us it ain't like that. We got a killed wore one on his left crushed Curley' gets to ___ and nobody gets no 's ___ bait all set on the George and Lennie hope to own is mentally slow but physically shot Lennie with 's last carried a dead one in his breaks Curley's wife' Lennie liked to do to the dead Slim has that Lennie Lennie wants to tend was accused of this in few miles south of Soledad, this river runs deep and don't need no ___ to be a nice tell ya a guy gets too lonely an' he gets 's last game George 's wife acts like George and Lennie had to Mice and Men Fill In The Blanks 1 George and Lennie had to leave.

3 Man is mentally slow but physically strong. was accused of this in Weed. carried a dead one in his pocket. 's ___ bait all set on the trigger. game George plays us it ain't like that. We got a ___. Candy's and Lennie, for often did this; didn't 's aunt who gave him offers to go away and live in don't need no ___ to be a nice in son of the ranch shot Lennie with killed always ____s about wore one on his left Mice and Men Matching 1___ 's aunt who gave him mice___ Slim has that Lennie wants___ and Lennie, for example___ George and Lennie hope to own someday___ often did this; didn't 's wife acts like foreman___ done a ___ thing. I done another ___ hand's for a ranch hand's wore one on his left George and Lennie had to always ____s about killed Curley likes to in place ranchers stay don't need no ___ to be a nice to keep animals and store son of the ranch 's last was accused of this in few miles south of Soledad, this river runs deep and Mice and Men Magic Squares 1 Match the definition with the vocabulary word.

4 Put your answers in the magic squaresbelow. When your answers are correct, all columns and rows will add to the CLARAE. NECKI. CARLSONM. CROOKSB. RAPEF. GLOVEJ. COMPLAINN. RABBITSC. CURLEYG. CAMPSITEK. HANDO. MOUSED. FORGOTH. PUPPIESL. SOLITAIREP. BEANS 1. Lennie was accused of this in Weed. 2. Outdoor place ranchers stayovernight 3. Lennie crushed Curley's 4. What Lennie wants to tend someday 5. Stable man 6. Card game George plays 7. What Slim has that Lennie wants 8. Lennie's aunt who gave him mice 9. George had 4 cans of these to eat;Lennie liked ketchup on his10. Killed Candy's dog11. Lennie breaks Curley's wife's12. Lennie often did this; didn' Ill-tempered son of the ranch owner14. Curley wore one on his left George always ____s about Lennie carried a dead one in Mice and Men Word Search 1 LIAJGEORGEZNCURLEYRDHACQLJSBCMROTSWKHLAQ EDNAEZSNZANSKLTCDDBPACPDNSWFBYILCSICKBBH VNLQNDPIWCARELFRPRISEFHAIRYGQCLABQAOPSTS NNENEQPHLXPCNLLRRTSDJBFFDNOTLIMHIDFCAGNM CFANBCWBTXOCEDGAWPOGTCADVRYHRWCETQNMBBMT FHJTWOBUNKWWSEIPPUPBGQVLKORSVQFFSTWSYPSL RHSPPKHQPSRJKZRIDWOQVYYPWSFYYZIZTRNTDTLH WHRBHAWBYKEFBXWEBSIKPLDRMLTGMGNUGSTKISTH JPBLYIBWLXDTTCMLNMAFBQLOWNLCKOSUTRAJDAIH KVMTSATCHTVRRPAVLLRTSSKRFSBSENSESUOMELES SYDGLGPNELGMBHIHPPPSZJGJGBXCCURJLLZDHNAR MMFKGSKMLWYLSSRBGDRRA few miles south of Soledad, this river runs deep and green.

5 (7)Author (9)Card game George plays (9)Curley wore one on his left hand. (5)Curley's wife acts like one. (5)George always ____s about Lennie. (8)George and Lennie, for example (7)George had 4 cans of these to eat; Lennie liked ketchup on his (5)George shot Lennie with it. (5)George's last name (6)Guy don't need no ___ to be a nice fella (5)He is mentally slow but physically strong. (6)He killed Lennie. (6)I done a ___ thing. I done another ___ thing. (3)I tell ya a guy gets too lonely an' he gets ___. (4)Ill-tempered son of the ranch owner (6)Killed Candy's dog (7)Lennie breaks Curley's wife's (4)Lennie carried a dead one in his pocket. (5)Lennie crushed Curley's (4)Lennie offers to go away and live in one. (4)Lennie often did this; didn't remember. (6)Lennie was accused of this in Weed. (4)Lennie's aunt who gave him mice (5)Lennie's last name (5)Nobody gets to ___ and nobody gets no land. (6)Old swamper whose dog was killed (5)One in charge (4)Outdoor place ranchers stay overnight (8)Place to keep animals and store hay (4)Ranch foreman (4)Ranch hand's bed (4)She's ___ bait all set on the trigger.

6 (4)Slang for a ranch hand's bedroll (6)Stable man (6)Town George and Lennie had to leave. (4)What Curley likes to do (5)What George and Lennie hope to own someday (4)What Lennie liked to do to the dead mouse (3)What Lennie wants to tend someday (7)What Slim has that Lennie wants (7)With us it ain't like that. We got a ___. (6) of mice and men Crossword 1123456789101112131415161718192021222324 25 Across 2. A few miles south of Soledad, this river runsdeep and green. 5. Lennie breaks Curley's wife's 7. She's ___ bait all set on the trigger. 8. Old swamper whose dog was killed10. What Lennie liked to do to the dead mouse11. Lennie carried a dead one in his Ranch foreman13. Place to keep animals and store hay15. What Curley likes to do16. Lennie offers to go away and live in Nobody gets to ___ and nobody gets no Curley wore one on his left George shot Lennie with One in charge24. George's last name25.

7 Ill-tempered son of the ranch ownerDown 1. Curley's wife acts like one. 2. Card game George plays 3. He is mentally slow but physically strong. 4. Guy don't need no ___ to be a nice fella 6. Outdoor place ranchers stay overnight 8. Lennie's aunt who gave him mice 9. Lennie often did this; didn't Lennie's last name13. I done a ___ thing. I done another ___ Lennie was accused of this in George and Lennie, for example17. Town George and Lennie had to Lennie crushed Curley's19. He killed With us it ain't like that. We got a Ranch hand's bed23. I tell ya a guy gets too lonely an' he gets Mice and MenGEORGEBADFORGOTCURLEYHANDRABBITSRAPEB EANSSLIMBUNKWEEDCANDYFREE SPACEBINDLECLARASTEINBECKFUTUREMOUSESALI NASNECKFRIENDSCAVEPETTRAMPMILTONOf Mice and MenCAMPSITECOMPLAINGLOVEBARNPUPPIESJAILS ENSELENNIESOLITAIRESICKLUGERLANDFREE SPACECARLSONSMALLFIGHTHEAVENMILTONTRAMPP ETCAVEFRIENDSNECKSALINASMOUSE


Related search queries