Example: bachelor of science

Puzzles and Quizzes - Music Fun

Puzzles and QuizzesContents 2011by Beatrice WilderSheet 1 Name the Percussion Instrument QuizSheet 2 Name the Orchestral Instrument QuizSheet 3 Percussion WordsearchSheet 4 Music Symbol WordsearchSheet 5 Peter and the Wolf WordsearchSheet 6 Instrument Word PuzzlesSheet 7 Music Symbols Word PuzzlesSheet 8 Nursery Rhymes Word PuzzleSheet 9 Create a NoteSheet 10 Information Sheet 11 AnswersCopyright Beatrice Wilder 2011 Published in 2011 by Music Box 342 Katoomba NSW 278019 Millyard Lane Katoomba 2780 Phone: (02) 4782 3073 Fax: (02) 4782 6362 Email.

bass clef treble clef alto clef staff bar lines double bar lines repeat signs breath mark engage pedal release pedal da capo semibreve/ whole note minim/ half note crotchet/ quarter note quaver/ eighth note semiquaver/ sixteenth note sharp double sharp flat double flat natural semibreve/ whole note rest minim/ half note rest crotchet/ quarter ...

Tags:

  Bass

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of Puzzles and Quizzes - Music Fun

1 Puzzles and QuizzesContents 2011by Beatrice WilderSheet 1 Name the Percussion Instrument QuizSheet 2 Name the Orchestral Instrument QuizSheet 3 Percussion WordsearchSheet 4 Music Symbol WordsearchSheet 5 Peter and the Wolf WordsearchSheet 6 Instrument Word PuzzlesSheet 7 Music Symbols Word PuzzlesSheet 8 Nursery Rhymes Word PuzzleSheet 9 Create a NoteSheet 10 Information Sheet 11 AnswersCopyright Beatrice Wilder 2011 Published in 2011 by Music Box 342 Katoomba NSW 278019 Millyard Lane Katoomba 2780 Phone: (02) 4782 3073 Fax: (02) 4782 6362 Email.

2 Score out of 12: ..Sheet 1 - Name the Percussion InstrumentA. CymbalsA. XylophoneA. ChimesA. TimpaniA. Bongo DrumsB. Kettle DrumB. TambourineB. KeyboardB. Sleigh BellsB. Hi-HatB. bass DrumsC. ShakerC. MetallophoneC. TamborineC. Finger CymbalsC. Timpani D. Metallophone D. Vibraphone D. Marimba D. Tam-tam D. Tenor bass DrumC. Snare Drum D. Conga Drum A. MetallophoneB. CymbalsC. Chimes D. XylophoneA. TriangleB.

3 WhipC. Whistle D. RattleA. Sleigh BellsB. MaracasC. Cabasa D. Cow BellsA. ClackersB. CymbalsC. Claves D. CastanetsPuzzles and QuizzesA. RatchetB. ClavesC. Slapstick D. CelesteA. ScraperB. Temple BlocksC. Maracas D. WoodblocksName ..Score out of 12: ..Sheet 2 - Name the Orchestral InstrumentsPuzzles and QuizzesA. OboeA. Fluegel HornA. Tom tomsA. PiccoloA. TrumpetB. FluteB. PiccoloB. Vienna HornB. TimpaniB. OboeB. French HornC.

4 ClarinetC. English HornC. CongasC. ClarinetC. Tuba D. Bassoon D. French Horn D. Bongos D. Cor anglais D. TromboneA. Cor AnglaisC. Viola D. ClarinetA. ClarinetB. EuphoniumC. Oboe D. French HornA. GuitarB. HarpC. Banjo D. ViolinA. PiccoloB. BassoonC. English Horn D. bass ClarinetA. French HornB. TrumpetC. Trombone D. TubaA. French HornB. TromboneC. Trumpet D.

5 BassoonA. Grand PianoB. Upright PianoC. Player Piano D. HarpsichordName ..Score out of 20: ..Sheet 3 - Percussion WordsearchPuzzles and QuizzesSKCOLBELPMETHLSKSAGNOCEGUPALSXKCI TSPALSBLTLYCYMBALSTMETALLOPHONEIYBMSMEOL VDSMMRGFBRZODHDJHAEIXADAAUNOOCNGEDCEQCRR ANOINLCRRLLACIHEWISEVALCLSPNKTFELGNAIRTF ZERMURDSSABONGOSCHBAUBBPBAWIPName ..Score out of 20: ..Sheet 4 - Music Symbol WordsearchPuzzles and QuizzesGMTIQUAVERTVBFRFPAUSENUABMEEPEJPE FCDLIVLAZEDECBOANACCARLESSCRIUSTOCNGHEFT AIALTALFRNVAGMBLDACAPOCNKEVERBIMESBNRSEN ILRABDLTEHCTORCYSKNSTAVEBQHNZBWUMQSMETKF AGRName ..Sheet 5 - Peter and the Wolf WordsearchPuzzles and QuizzesThe _ _ _ _ _ _ _ _ is _ _ _ _ _ _ _ _ _ _ _ _ _ _ Its first performance is in _ _ _ _ _ _ _ _ _ is a _ _ _ _ _ _ _ _ _ _ and lives with his_ _ _ _ _ _ _ _ _ _ _ in a clearing in the _ _ _ _ _ _.

6 He is represented by _ _ _ _ _ _ _. One day he leaves the _ _ _ _open and the _ _ _ _ represented by an _ _ _ _ escapes andgoes for a _ _ _ _ in the _ _ _ _ _ _, represented by a _ _ _ _ _ _ _ _ sneaks up on a _ _ _ _ ( _ _ _ _ _ ) which decides to _ _ _ into a _ _ _ ( _ _ _ _ _ _ _ ) _ _ _ _ _ _ Peter and _ _ _ _ _ thegate. Peter _ _ _ _ _ _ over the _ _ _ _ _ _ _ _ _ _. A _ _ _ _(_ _ _ _ _ _ _ _ _ _ _ ) comes and _ _ _ _ _ _ _ _ the makes a _ _ _ _ _ with a _ _ _ _ to catch the horngardengategrandfatherlocksName ..Sheet 6 - Instrument Word PuzzlesPuzzles and QuizzesWrite the names of the instruments and choose just one letter from each name to makea new word which is the name of a woodwind the names of the instruments and choose just one letter from each name to makethe name of instruments belonging to the family of the names of the instruments and choose just one letter from each name to makea new word which is the name of a stringed.

7 Sheet 7 - Music Symbols Word PuzzlesPuzzles and QuizzesWrite the names of the Music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the Music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the Music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the Music symbols and choose just one letter from each name to makea new word which is the name of a different symbol.

8 Draw a picture of it in the green ..tdien dideldelded he cdaht l a tdhde fyilar dinn idosw infloggeblondwheev wa n onl wamadoahot lised i horsenmogl kslunaserle wi ard co y dolobot omde cber huharu whntdtalobep trode qtae meadn foearetshme tuhe so shrtsSheet 8 - Nursery Rhymes Word PuzzlesPuzzles and QuizzesAll the letters have fallen out of this puzzle and become mixed need to be put back. Unscramble the letters to make the openinglines of well known Nursery Rhymes. Use each letter only ..Sheet 9 - Create a NotePuzzles and QuizzesRemember these four parts of a musical noteUsing the above parts, make and name these notes:note headstemflagbeamdotThe note is called a:The note is called a:The note is called a:The note is called a:You have drawn:The note is called a:The note is called a:The note is called a:You have drawn:You have drawn:The note is called a:You have drawn:1.

9 Use just a note head and leave it hollow in the middle5 Use a note head and a stem and add a dot after the note head9 Use a note head and a stem and twoflags2 Use a note headand a stem6 Use two note headsand two stems andjoin the stems at the top with two beams3 Use a note headand a stem but leavethe note head hollow7 Use a note headand a stem and a flag4 Use two note headsand two stems andjoin the stems at the top with a beam8 Use one note head, hollow, one stem andone dot10 Use a note headand a stem and twoflags and a dot11 Use three note heads, three stems and one beam12 Use three note heads, three stems and two beamsName.

10 Information Symbols used in this bookMusical InstrumentsPuzzles and Quizzesaccentsegnocodabasscleftrebleclef altoclefstaffbar linesdoublebar linesrepeatsignsbreathmarkengage pedalreleasepedalda caposemibreve/whole noteminim/half notecrotchet/quarter notequaver/eighth notesemiquaver/sixteenth notesharpdouble sharpflatdouble flatnaturalsemibreve/whole noterestminim/half noterestcrotchet/quarter noterestquaver/eighth noterestsemiquaver/sixteenth noterestkeysignaturetimesignaturepausemo rdentSheet 2 - Name the OrchestralInstrument1. B. Flute2. A. Clarinet3. D. Violin4. B. Bassoon5. C. Trombone6. A. Oboe7. D. French Horn8.


Related search queries