Example: marketing

Puzzles and Quizzes - musicfun.net.au

Puzzles and QuizzesContents 2011by Beatrice WilderSheet 1 Name the Percussion Instrument QuizSheet 2 Name the Orchestral Instrument QuizSheet 3 Percussion WordsearchSheet 4 music Symbol WordsearchSheet 5 Peter and the Wolf WordsearchSheet 6 Instrument Word PuzzlesSheet 7 music Symbols Word PuzzlesSheet 8 Nursery Rhymes Word PuzzleSheet 9 Create a NoteSheet 10 Information sheet 11 AnswersCopyright Beatrice Wilder 2011 Published in 2011 by music Box 342 Katoomba NSW 278019 Millyard Lane Katoomba 2780 Phone: (02) 4782 3073 Fax: (02) 4782 6362 Email: ..Score out of 12: .. sheet 1 - Name the Percussion InstrumentA. CymbalsA. XylophoneA. ChimesA. TimpaniA. Bongo DrumsB. Kettle DrumB. TambourineB. KeyboardB. Sleigh BellsB. Hi-HatB.

Name ..... Sheet 7 - Music Symbols Word Puzzles Puzzles and Quizzes Write the names of the music symbols and choose just one letter from each name to make

Tags:

  Sheet, Music

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of Puzzles and Quizzes - musicfun.net.au

1 Puzzles and QuizzesContents 2011by Beatrice WilderSheet 1 Name the Percussion Instrument QuizSheet 2 Name the Orchestral Instrument QuizSheet 3 Percussion WordsearchSheet 4 music Symbol WordsearchSheet 5 Peter and the Wolf WordsearchSheet 6 Instrument Word PuzzlesSheet 7 music Symbols Word PuzzlesSheet 8 Nursery Rhymes Word PuzzleSheet 9 Create a NoteSheet 10 Information sheet 11 AnswersCopyright Beatrice Wilder 2011 Published in 2011 by music Box 342 Katoomba NSW 278019 Millyard Lane Katoomba 2780 Phone: (02) 4782 3073 Fax: (02) 4782 6362 Email: ..Score out of 12: .. sheet 1 - Name the Percussion InstrumentA. CymbalsA. XylophoneA. ChimesA. TimpaniA. Bongo DrumsB. Kettle DrumB. TambourineB. KeyboardB. Sleigh BellsB. Hi-HatB.

2 Bass DrumsC. ShakerC. MetallophoneC. TamborineC. Finger CymbalsC. Timpani D. Metallophone D. Vibraphone D. Marimba D. Tam-tam D. Tenor Bass DrumC. Snare Drum D. Conga Drum A. MetallophoneB. CymbalsC. Chimes D. XylophoneA. TriangleB. WhipC. Whistle D. RattleA. Sleigh BellsB. MaracasC. Cabasa D. Cow BellsA. ClackersB. CymbalsC. Claves D. CastanetsPuzzles and QuizzesA. RatchetB. ClavesC. Slapstick D. CelesteA. ScraperB. Temple BlocksC. Maracas D. WoodblocksName ..Score out of 12: .. sheet 2 - Name the Orchestral InstrumentsPuzzles and QuizzesA.

3 OboeA. Fluegel HornA. Tom tomsA. PiccoloA. TrumpetB. FluteB. PiccoloB. Vienna HornB. TimpaniB. OboeB. French HornC. ClarinetC. English HornC. CongasC. ClarinetC. Tuba D. Bassoon D. French Horn D. Bongos D. Cor anglais D. TromboneA. Cor AnglaisC. Viola D. ClarinetA. ClarinetB. EuphoniumC. Oboe D. French HornA. GuitarB. HarpC. Banjo D. ViolinA. PiccoloB. BassoonC. English Horn D. Bass ClarinetA. French HornB. TrumpetC. Trombone D. TubaA. French HornB. TromboneC. Trumpet D. BassoonA. Grand PianoB. Upright PianoC.

4 Player Piano D. HarpsichordName ..Score out of 20: .. sheet 3 - Percussion WordsearchPuzzles and QuizzesSKCOLBELPMETHLSKSAGNOCEGUPALSXKCI TSPALSBLTLYCYMBALSTMETALLOPHONEIYBMSMEOL VDSMMRGFBRZODHDJHAEIXADAAUNOOCNGEDCEQCRR ANOINLCRRLLACIHEWISEVALCLSPNKTFELGNAIRTF ZERMURDSSABONGOSCHBAUBBPBAWIPName ..Score out of 20: .. sheet 4 - music Symbol WordsearchPuzzles and QuizzesGMTIQUAVERTVBFRFPAUSENUABMEEPEJPE FCDLIVLAZEDECBOANACCARLESSCRIUSTOCNGHEFT AIALTALFRNVAGMBLDACAPOCNKEVERBIMESBNRSEN ILRABDLTEHCTORCYSKNSTAVEBQHNZBWUMQSMETKF AGRName .. sheet 5 - Peter and the Wolf WordsearchPuzzles and QuizzesThe _ _ _ _ _ _ _ _ is _ _ _ _ _ _ _ _ _ _ _ _ _ _ Its first performance is in _ _ _ _ _ _ _ _ _ is a _ _ _ _ _ _ _ _ _ _ and lives with his_ _ _ _ _ _ _ _ _ _ _ in a clearing in the _ _ _ _ _ _ .He is represented by _ _ _ _ _ _ _.

5 One day he leaves the _ _ _ _open and the _ _ _ _ represented by an _ _ _ _ escapes andgoes for a _ _ _ _ in the _ _ _ _ _ _, represented by a _ _ _ _ _ _ _ _ sneaks up on a _ _ _ _ ( _ _ _ _ _ ) which decides to _ _ _ into a _ _ _ ( _ _ _ _ _ _ _ ) _ _ _ _ _ _ Peter and _ _ _ _ _ thegate. Peter _ _ _ _ _ _ over the _ _ _ _ _ _ _ _ _ _. A _ _ _ _(_ _ _ _ _ _ _ _ _ _ _ ) comes and _ _ _ _ _ _ _ _ the makes a _ _ _ _ _ with a _ _ _ _ to catch the horngardengategrandfatherlocksName .. sheet 6 - Instrument Word PuzzlesPuzzles and QuizzesWrite the names of the instruments and choose just one letter from each name to makea new word which is the name of a woodwind the names of the instruments and choose just one letter from each name to makethe name of instruments belonging to the family of the names of the instruments and choose just one letter from each name to makea new word which is the name of a stringed.

6 sheet 7 - music Symbols Word PuzzlesPuzzles and QuizzesWrite the names of the music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green the names of the music symbols and choose just one letter from each name to makea new word which is the name of a different symbol. Draw a picture of it in the green ..tdien dideldelded he cdaht l a tdhde fyilar dinn idosw infloggeblondwheev wa n onl wamadoahot lised i horsenmogl kslunaserle wi ard co y dolobot omde cber huharu whntdtalobep trode qtae meadn foearetshme tuhe so shrtsSheet 8 - Nursery Rhymes Word PuzzlesPuzzles and QuizzesAll the letters have fallen out of this puzzle and become mixed need to be put back.

7 Unscramble the letters to make the openinglines of well known Nursery Rhymes. Use each letter only .. sheet 9 - Create a NotePuzzles and QuizzesRemember these four parts of a musical noteUsing the above parts, make and name these notes:note headstemflagbeamdotThe note is called a:The note is called a:The note is called a:The note is called a:You have drawn:The note is called a:The note is called a:The note is called a:You have drawn:You have drawn:The note is called a:You have drawn:1. Use just a note head and leave it hollow in the middle5 Use a note head and a stem and add a dot after the note head9 Use a note head and a stem and twoflags2 Use a note headand a stem6 Use two note headsand two stems andjoin the stems at the top with two beams3 Use a note headand a stem but leavethe note head hollow7 Use a note headand a stem and a flag4 Use two note headsand two stems andjoin the stems at the top with a beam8 Use one note head, hollow, one stem andone dot10 Use a note headand a stem and twoflags and a dot11 Use three note heads, three stems and one beam12 Use three note heads, three stems and two beamsName.

8 Information Symbols used in this bookMusical InstrumentsPuzzles and Quizzesaccentsegnocodabasscleftrebleclef altoclefstaffbar linesdoublebar linesrepeatsignsbreathmarkengage pedalreleasepedalda caposemibreve/whole noteminim/half notecrotchet/quarter notequaver/eighth notesemiquaver/sixteenth notesharpdouble sharpflatdouble flatnaturalsemibreve/whole noterestminim/half noterestcrotchet/quarter noterestquaver/eighth noterestsemiquaver/sixteenth noterestkeysignaturetimesignaturepausemo rdentSheet 2 - Name the OrchestralInstrument1. B. Flute2. A. Clarinet3. D. Violin4. B. Bassoon5. C. Trombone6. A. Oboe7. D. French Horn8. B. Timpani. 9. A. Piccolo10. C. Trumpet11. A. Grand Piano12. C. TubaSheet 3 - Percussion WordsearchSheet 1 - Name the Percussion Instrument 1. C. Snare Drum2. B. Cymbals3. A. Triangle4. C. Cabasa5. D. Castanets6.

9 B. Tambourine7. A. Xylophone8. B. Sleigh Bells9. C. Finger Cymbals10. C. Slapstick11. D. Woodblocks12. A. Bongo DrumsSheet 4 - music Symbol WordsearchThe AnswersName .. sheet 7 - music SymbolsSheet 8 - Nursery RhymesSheet 9 - Create a notePuzzles and QuizzesSKCOLBELPMETHLSKSAGNOCEGUPALSXKCI TSPALSBLTLYCYMBALSTMETALLOPHONEIYBMSMEOL VDSMMRGFBRZODHDJHAEIXADAAUNOOCNGEDCEQCRR ANOINLCRRLLACIHEWISEVALCLSPNKTFELGNAIRTF ZERMURDSSABONGOSCHBAUBBPBAWIPGMTIQUAVERT VBFRFPAUSENUABMEEPEJPEFCDLIVLAZEDECBOANA CCARLESSCRIUSTOCNGHEFTAIALTALFRNVAGMBLDA CAPOCNKEVERBIMESBNRSENILRABDLTEHCTORCYSK NSTAVEBQHNZBWUMQSMETKFAGRCLARINETFORESTW OLFSTRINGSPNSRUSSIANSERGEIWGRANDFATHERTJ AWRJAOPROKOFIEVLHLOMOBASSOONRTLGLVPSBTGA RDENQOBAFGEDCOMPOSERWDWFRENCHHORNPSSDSFL UTEYYTSEKKDEWXBIRDLGMOCCPTCIOOHEFGUBOUOA HOMWYYESCOLDSGWTZPONDCLIMBSNCATW handbellsgrand pianosleigh bellsslapstickxylophonewoodblockscastane tsBASSOON tambourineviolintrombonepiccolomaracasbo ngosfinger cymbalsTIMPANI clavestriangleoboeflutechimesclarinetVIO LINS heet 6 - Instrument Word

10 PuzzlesJNVS heet 5 - Peter and the WolfThe composer is Sergei Prokofiev. Its first performance is in is a Russian boy and lives with his grandfather in a clearing in the forest. He is represented by strings. One day he leaves the gate open and the duck, represented by an oboe, escapes and goes for a swim in the pond. A cat, represented by a clarinet, sneaks up on a bird (flute) which decides to fly into a tree. Grandfather ( bassoon) scolds Peter and closes thegate. Peter climbs over the garden wall. A wolf (french horns) comes and swallows the duck. Peter makes a noose with a rope to catch the markflattreble clefpauseSHARPda capobass clefnaturalkey signaturesegnoPAUSEbar linesaccentquaver restalto clefdouble flatSTAFF semiquaverrepeat signtime signaturemordentcodaSEGNO1 Old King Cole was a Merry Old Soul2 Hey Diddle Diddle the Cat and the Fiddle3 Old Mother Hubbard went to the Cupboard4 The Queen of Hearts she made some Tarts5 London Bridge is Falling Down6 There was an Old Woman who Lived in a Shoe1 Semibreve or whole note2 Crotchet or quarter note3 Minim or half note4 Two quavers or eighth notes joined5 Dotted crotchet or quarter note6 Two semiquavers or sixteenth notes joined7 One quaver or eighth note8 Dotted minim or half note9 A semiquaver or sixteenth note10 A dotted semiquaver or sixteenth note11 Three quavers or eighth notes joined12 Three semiquavers or


Related search queries