Example: tourism industry

SCREEN-PROTECTOR - Mobilis

SCREEN-PROTECTORANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPA A & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & STERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : | For more informations, visit our website : finish 180 Privacy filter Clear finish99% transparencyMatte finishAnti-fingerprintAnti-glarePackagin g for Anti-ShockComposed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardPackaging for Tempered Glass(in Polycarbonate)Composed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardTYPOLOGYANTI-SCRATCH TEMPERED GLASS 9 HANTI-SHOCK IK06 FINISHCLEARMATTECLEARMATTEPRIVACYCLEARMA TTEPRIVACYIK ANTI-SHOCK NORMIK02IK02IK03IK03IK03IK06IK06IK06 HARDNESS4H4H9H9H9H5H5H5 HBUBBLE FREE ANTI-FINGERPRINT ANTI-GLARE ABSORPTION ROUNDED CATEGORY PRIVACY FILTERSSCREEN PROTECTORSANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 596

SCREEN-PROTECTOR ANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPAÑA & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & ÖSTERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : infos@mobiliscase.com | For more …

Tags:

  Mobilis

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of SCREEN-PROTECTOR - Mobilis

1 SCREEN-PROTECTORANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPA A & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & STERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : | For more informations, visit our website : finish 180 Privacy filter Clear finish99% transparencyMatte finishAnti-fingerprintAnti-glarePackagin g for Anti-ShockComposed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardPackaging for Tempered Glass(in Polycarbonate)Composed of : 1 screen protector 1 cleaning kit : 1 cleaning pad+ 1 microfiber fabric + 1 anti-dust adhesive+ 1 smoothing cardTYPOLOGYANTI-SCRATCH TEMPERED GLASS 9 HANTI-SHOCK IK06 FINISHCLEARMATTECLEARMATTEPRIVACYCLEARMA TTEPRIVACYIK ANTI-SHOCK NORMIK02IK02IK03IK03IK03IK06IK06IK06 HARDNESS4H4H9H9H9H5H5H5 HBUBBLE FREE ANTI-FINGERPRINT ANTI-GLARE ABSORPTION ROUNDED CATEGORY PRIVACY FILTERSSCREEN PROTECTORSANNECY : +33 (0) 450 63 24 24 | PARIS : +33 (0) 146 43 92 00 | UK & IRELAND : +44 (0) 795 163 5969 | ESPA A & PORTUGAL : +34 (0) 91 655 5661 | DEUTSCHLAND & STERREICH : +49 (0) 160 96 336 400 | NETHERLANDS, NORTH AMERICA, EMEA, APAC, CIS, LATAM : | For more informations, visit our website.

2 Screen compatibleWith Mobilis privacy filters, check your sensitive data wherever you privacy filters use a microshutter technology which allows only the person in front of the screen to view the displayed data. People on either side only see essential protection allows you to work in total security whether in public spaces, trains, or even at the office! Compatible with laptops, hybrid PC and LCD screens Compatible with the major part of touchscreens 2 mounting systems to adapt to your requirements Not permanent, easily removable for teamwork Available from 12,1 to 24 Effectively protect your data from prying W (16:9) Dim : 276,6x155, W (16:10) Dim : 286, W (16:9) Dim : 294x165mm01622714 W (16:9) Dim : (4:3) Dim : W (16:10) Dim : 303,5x189, W (16:9) Dim : 310x175mm01623015 (4:3) Dim : W (16:10) Dim : 332,5x207, W (16:9) Dim : 344x194,5mm01623317 (4:3) Dim : 338x270mm01623417 W (16:10) Dim : W (16:9) Dim : W (16:9) Dim : 407x229mm01623719 (4:3) Dim : 377x302mm01623819 W (16:10) Dim : 409,5x257mm01623919 W (16:9) Dim : 409,8x230, W (16:9) Dim.

3 442, W (16:10) Dim : 434x271,5mm01624722 W (16:10) Dim : 474x297mm01624122 W (16:9) Dim : 476,6x268,1mm01624923 W (16:9) Dim : 509,8x286,7mm01624224 W (16:9) Dim : 531x298mm016243 Anti-ScratchAnti-Shock IK06 Tempered Glass 9 HProductClearMatteClearMattePrivacyClear MattePrivacyiPhone X036071037056016660016734iPhone 6/6S Plus040008041008036022037016039013016633 016711016907iPhone 8/7/6/6S04000104100103602103700103900101 6611016718016906iPhone 5/5S/SE040007041007037015039012016600016 709016905iPad Mini/Mini2/Mini4040009041009036035037032 039014016618016724016908iPad 2017 / Air / Air 2 / Pro A3 2017036046037043016640016725 Galaxy A5 2017040029041031036047037044016641016726 Galaxy S7040019041019037022 Galaxy J3 2016040017041017016626 Galaxy J3 2017036063037061016655016738 Galaxy J5 2017036064037062016656016737 Galaxy J7 2016040018041018016627 Galaxy J7 2017036065037063016657016739 Galaxy Tab S2 8040020041020036028037023039020 Galaxy Tab S2

4 Pro 3/4040022041022036030037010039022016619 Smartphone 016646 Smartphone 016647 Smartphone 016648 Smartphone 5,3-5,5 016649 These protections are really easy to set with their bubble free technology wich avoids the unpleasant and difficult moment of applying the screen protector. If any small bubble appears during the set-up, it will automatically disappear within anti-glare feature prevents the reflection of sun and lighting on screens, allowing users to check their devices in luminous places without being constrained by t be afraid of coffee drips, food spots or dust traces anymore. With their matte finish, anti-stain screen protectors prevent any mark from staining your IK standard defines the degree of protection against external mechanical shocks. It is standardized according to NF EN 62262 (NF C 20-015).

5 The IK06 rating indicates resistance to a 1-joule impact (equivalent to the impact of a 250gr mass dropped from a height of 40cm).9H is the hardest grade (behind diamond, which is 10H) on a scale defining resistance to touch, pressure, shearing, chafing and shock. Therefore, 9H is the best degree of anti-scratch protection that exists for with regular cleaning, fingerprints and smudges are always visible on your smartphones and tablets touchscreens. Thanks to its anti-fingerprint effect, a matte finish prevents this electricity causes dust and dirt to adhere to all kinds of screens. It interferes with your usage and reduces the lifetime of your devices. Electrostatic absorption technology eliminates static its 60 angle of visibility, the privacy filter protects your data from curious or prying normAnti-scrAtch hArdnessAnti-fingerPrintBuBBle freeAnti-glAreoleoPhoBicelectrostAtic ABsorPtionPrivAcy finishPackaging composed of : Privacy filter, in transparent sleeve Instructions for use 1 anti-dust adhesive Adhesive pads 1 microfiber fabric Hang tabsADHESIVE PADS INSTALLATIONHANG TABS INSTALLATIONL aptopLCD ScreenHybrid PC


Related search queries