Example: marketing

Sight Word/Decodable Word List

MLPP Second Edition/2000139 Proof #6 4/20/01 Section IXSight Word/Decodable Word ListRationaleOnce children are able to use several sources of information effectively while reading they will be onthe way to becoming more fluent. Knowledge of Sight words and efficiency in word recognition helpchildren develop their understanding of increasingly complex pieces of written language. It helpsthem develop speed and accuracy. To establish instructional priorities for each child in the earlystages of literacy development, the Sight Word/Decodable Word List assessment will be adminis-tered. This assessment helps teachers understand what individual children know specifically aboutword recognition. Teachers observations are crucial and critical factors informing their deci-sions about whom and when to recognition has two equally important aspects.

stages of literacy development, the Sight Word/Decodable Word List assessment will be adminis- tered. This assessment helps teachers understand what individual children know specifically about

Tags:

  Assessment, Lists, Sight, Words, Decodable, Sight word decodable word list, Sight word decodable word list assessment

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of Sight Word/Decodable Word List

1 MLPP Second Edition/2000139 Proof #6 4/20/01 Section IXSight Word/Decodable Word ListRationaleOnce children are able to use several sources of information effectively while reading they will be onthe way to becoming more fluent. Knowledge of Sight words and efficiency in word recognition helpchildren develop their understanding of increasingly complex pieces of written language. It helpsthem develop speed and accuracy. To establish instructional priorities for each child in the earlystages of literacy development, the Sight Word/Decodable Word List assessment will be adminis-tered. This assessment helps teachers understand what individual children know specifically aboutword recognition. Teachers observations are crucial and critical factors informing their deci-sions about whom and when to recognition has two equally important aspects.

2 First, a reader must have a large Sight wordvocabulary ( words recognized automatically). Second, a reader must have multiple strategies fordecoding (using knowledge of symbol-sound correspondences) to identify unfamiliar GuidelinesGeneral InstructionsChildren should be assessed individually. The assessment area should be quiet and free from majordistraction. Generally, a small table where the teacher can sit beside the child is a card or cover sheet, slowly expose one word at a time starting with the Preprimer wordlist. Move from one list to the next until the child either misses five consecutive words or sevenwords on one a child misses five consecutive words , remove the card or cover sheet, and ask the child, Doyou know any of the other words on the list? a check ( ) in the column next to the word if the child correctly identifies the incorrect responses (mispronunciations/substitutions) next to the word on the child sreporting Second Edition/2000140 Proof #6 4/20 the number of correct responses in each completed and record on the student record sheet the score of the highest list where the studentscored a minimum of incorrect responses, mispronunciations, and substitutions to determine the child s strengthsand areas for instruction.

3 Examples of issues to consider in analysis are reversals, word families,chunking, recognition of decodable words , and words which are highly abstract or concrete. Anotherarea to consider is the relationship of the child s performance on this assessment and her/his writingand oral reading Second Edition/2000141 Proof #6 4/20/01 Adapted from: Taylor, B.; Dewitz, P.; & Pearson, (1997). The CIERA early assessment battery for studying schools that beat the odds. Ann Arbor, MI: Center for the Improve-ment of Early Reading Word/Decodable Word ListStudent s Name _____ Grade _____ Date _____The interlocking circles at the top of this page are to encourage teachers to remember that while the lists are presented under specific grade headings a student may be within adevelopmental stage that is not tightly aligned with a grade level designation.

4 A teacher at any specific grade provides instruction to students who possess a range of knowl-edge and performance GradeSecond GradeThird Gradeandthereeachstillcompletetodolikefo odanythingyouhowthroughroomwearthatabout newmoneysheepwassomegoodmorningnationthe ytheseanynoticedblowhiswouldrightbeginsp eaceathasalsoweatherclimatefromhimcomefr iendroughIseebecausesentstrucknotcoulddo esinsectsspeakinghadmakesaytrademagicwha twhogiveclocklionallgetairgatecrowdedanl ookboypainremovedsaidbigmotherbreathewoo lmanhomepointprideworriedstopredmoveprom iseclawsmapruntruecluestampsbaddogroadha tchsensesTotalTotalTotalTotalTotalMLPP Second Edition/2000142 Proof #6 4/20/01andnottohadyouwhatthatallwasanthe ysaidhismanatstopfrommapIbadSight Word/Decodable Word ListMLPP Second Edition/2000143 Proof #6 4/20/01therecoulddomakehowwhoaboutgetsom elookthesebigwouldhomehasredhimrunseedog Sight Word/Decodable Word ListMLPP Second Edition/2000144 Proof #6 4/20/01eachdoeslikesaythroughgivenewairg oodboyanymotherrightpointalsomovecometru ebecauseroadSight Word/Decodable Word ListMLPP Second Edition/2000145 Proof #6 4/20/01stillinsectsfoodtraderoomclockmon eygatemorningpainnoticedbreathebeginspri deweatherpromisefriendcluesenthatchSight Word/Decodable Word ListMLPP Second Edition/2000146 Proof #6 4/20/01completespeakinganythingmagicwear lionsheepcrowdednationremovedblowwoolpea ceworriedclimateclawsroughstampsstruckse nsesSight Word/Decodable Word List


Related search queries