Example: marketing

Sizing Schedule Data - Best Materials

ROOF DRAIN TO ROOF AREA Sizing SCHEDULEUse the above sketch in combination with the table of the variable rainfall rates below to determine the appropriate quantityand size of the roof drains required when you know:a) the total roof areab) the approximate drain diameter you will useNote: When determining the number roof drains required recognize that the smaller the roof drain outlet diameterthe more drains you will need. Conversely, the larger the drain outlet diameter the fewer you will to calculate the quantity of drains required:1.) Calculate the roof area to be ) Estimate the roof drain outlet size you will likely : Roof area is 200' x 500' = 100,000 sq. : 4' roof drain3.) Determine your building s location on the above map to determine the approximate rainfall as measured in inches per : The location of Kansas City, MO shows 6" of rainfall per ) Select a reference of a roof drain size with hourly rainfall together with the roof area square footage you have estimatedand then determine from the chart below how many roof drains you : Each 4" drain size in a 6" hourly rainfall area will accommodate drainage of 3,070 sq.

ROOF DRAIN TO ROOF AREA SIZING SCHEDULE Use the above sketch in combination with the table of the variable rainfall rates below to determine the appropriate quantity

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of Sizing Schedule Data - Best Materials

1 ROOF DRAIN TO ROOF AREA Sizing SCHEDULEUse the above sketch in combination with the table of the variable rainfall rates below to determine the appropriate quantityand size of the roof drains required when you know:a) the total roof areab) the approximate drain diameter you will useNote: When determining the number roof drains required recognize that the smaller the roof drain outlet diameterthe more drains you will need. Conversely, the larger the drain outlet diameter the fewer you will to calculate the quantity of drains required:1.) Calculate the roof area to be ) Estimate the roof drain outlet size you will likely : Roof area is 200' x 500' = 100,000 sq. : 4' roof drain3.) Determine your building s location on the above map to determine the approximate rainfall as measured in inches per : The location of Kansas City, MO shows 6" of rainfall per ) Select a reference of a roof drain size with hourly rainfall together with the roof area square footage you have estimatedand then determine from the chart below how many roof drains you : Each 4" drain size in a 6" hourly rainfall area will accommodate drainage of 3,070 sq.

2 Ft. of roof , the 100,000 sq. ft. area roof will require 100,000 3070 = or 33 roof drains for ideal SCHEDULEWAORIDMTNVCAUTAZCOWYNMTXOKKSNESD NDMNWIILMOARLAMSALNCVAMINYPADENHMETNKYWV IASCNJGAFLINOHMDCTMARIVT3"3"3"3"3"6"6"6" 6"6"7"7"7"8"8"9"4"4"4"4"4"4"4"5"5"5"5"2" 2"2"1-1/2"1-1/2"DRAIN OUTLET SIZEHOURLY RAINFALL (in inches) (inches)(sq. inches) ,8801,9201,4401, ,8805,8604,4403,5202,9302,2001,7601,4701 ,2601, ,40012,7009,2007,3606,1304,6003,6803,070 2,6302, ,60023,05017,30013,84011,5308,6506,9205, 7654,9454, ,00036,00027,00021,60018,00013,50010,800 9,0007,7156, ,00077,40058,00046,40038,66029,00023,200 19,31516,57014,500 ROOF AREA SQUARE FOOTAGECALCULATE AREA DRAINAGE BY ROOF DRAIN SIZE AT VARIOUS RAINFALL RATES Sizing Schedule Data 2/10/03 1:22 PM Page 1


Related search queries