Example: barber

TERMS AND CONDITIONS - Freedom Tree Farms

1 TERMS AND CONDITIONSTERMSF reedom Tree Farms , LLC requires a 25% deposit on allcustomer orders. All new customers must have creditarrangements approved at least 30 days in advance of shipmentin order for credit TERMS to apply. Those with approved credit have30 days from shipping date to pay the balance in Tree Farms , LLC guarantees to ship well grown plants arrive damaged, Freedom Tree Farms , LLC should benotified by written claim within ten days of receipt of give no warranty, expressed or implied as to life, descriptionof quality, productiveness, or any matter of nursery stock or plantsthat we sell. It is mutually agreed that our total liability for anyerror, should stock prove untrue to name as labeled, shall belimited upon satisfactory proof to our replacing free or refundingthe purchase price orders subject to crop CONDITIONS , errors in count, and with theunderstanding that the order shall be void should injury befall the stockbecause of of 5 Trees Per Species, Per OrderMINIMUM ORDER 125 Tree Farms LLCPost Office Box 69 - Pelham, TN 37366 OFFICE: (931) 467-3600 FAX: (931) 467-3605 EMAIL: IN BAREROOT FRUIT& FLOWERING TREESE stablished in 1984, Freedom Tree Farms , LLC has continued supplyingAmerica s largest orchards, wholesale nurseries, and garden centers withnumerous varieties of the highest quality bareroot, fruit trees, shade andornamental Tree Fa

2 SPECIALIZING IN BAREROOT FRUIT & FLOWERING TREES Established in 1984, Freedom Tree Farms®, LLC has continued supplying America’s largest …

Tags:

  Terms, Conditions, Terms and conditions

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of TERMS AND CONDITIONS - Freedom Tree Farms

1 1 TERMS AND CONDITIONSTERMSF reedom Tree Farms , LLC requires a 25% deposit on allcustomer orders. All new customers must have creditarrangements approved at least 30 days in advance of shipmentin order for credit TERMS to apply. Those with approved credit have30 days from shipping date to pay the balance in Tree Farms , LLC guarantees to ship well grown plants arrive damaged, Freedom Tree Farms , LLC should benotified by written claim within ten days of receipt of give no warranty, expressed or implied as to life, descriptionof quality, productiveness, or any matter of nursery stock or plantsthat we sell. It is mutually agreed that our total liability for anyerror, should stock prove untrue to name as labeled, shall belimited upon satisfactory proof to our replacing free or refundingthe purchase price orders subject to crop CONDITIONS , errors in count, and with theunderstanding that the order shall be void should injury befall the stockbecause of of 5 Trees Per Species, Per OrderMINIMUM ORDER 125 Tree Farms LLCPost Office Box 69 - Pelham, TN 37366 OFFICE: (931) 467-3600 FAX: (931) 467-3605 EMAIL: IN BAREROOT FRUIT& FLOWERING TREESE stablished in 1984, Freedom Tree Farms , LLC has continued supplyingAmerica s largest orchards, wholesale nurseries, and garden centers withnumerous varieties of the highest quality bareroot, fruit trees, shade andornamental Tree Farms , LLC is the exception in the industry as we graft and budour own trees grown on over 550 acres of beautiful Tennessee farmland.

2 We arealso registered growers and grafters for many varieties of patented trees Color , TREESAPPLEPRICESQty3-4 4-5 Branched5-6 Branched6-8 + BlackRedPollinator Pink Lady RedSelf FertileSweet-TartCrisp6-9$ GoldYellowPollinator SmithGreenSelf FertileTartCrisp5-9 HoneycrispRedPollinator FertileSweet-TartCrisp4-8 McIntoshRedSelf FertileSweetCrisp4-8 Mollie DeliciousRedPollinator DeliciousRedPollinator Sweet GreenPollinator $ Green Urban Apple GreenPollinator $ Red Urban Apple RedPollinator $ SweetRedPollinator $ DeliciousYellowSelf FertileSweetCrisp5-9 DESCRIPTION4 FRUIT TREESPEARCHERRYVARIETYFRUIT COLORPOLLINATORTASTEZONESB lack TartarianDark RedPollinator FertileSour5-8 RainierYellowPollinator RedSelf FertileSweet5-9 BingDark RedPollinator Sweet5-8 North StarRedSelf FertileSour3-8 Qty3-4 4-5 Branched5-6 Branched6-8 + 4-5 Branched5-6 Branched6-8 + FertileSweetCrisp8-10 KiefferSelf FertileSweetCrisp4-9 MoonglowPollinator Century, AsianPollinator.

3 AsianPollinator , AsianPollinator TREESPEACHQty24 -30 30 -36 3 -4 + COLORSTONE FREENESSPOLLINATORTASTEZONESB elle of GeorgiaWhiteFreestoneSelf FertileSweet5-8 ContenderYellowFreestoneSelf FertileSweet4-8 ElbertaYellowFreestoneSelf FertileSweet5-8 FlordacrestYellowFreestoneSelf FertileVery Sweet8-9 FlordaprinceYellowFreestoneSelf FertileSweet8-9 JulyprinceYellowFreestoneSelf FertileSweet5-8 RedhavenYellowSemi-FreeSelf FertileSweet5-9 ScarletprinceYellowFreestoneSelf FertileMild5-8 Tropic BeautyYellowSemi-FreeSelf FertileVery Sweet9-10 Tropic SnowWhiteSemi-FreeSelf FertileSweet9-10 DESCRIPTION6 FRUIT TREESPLUM AND NECTARINEQty24 -30 30 -36 3 -4 + , Plum, Nectarine, and Apricot all budded on one tree. Self for zones 5-9 and zones 9A-10 availableVARIETYFLESH COLORSTONE FREENESSPOLLINATORTASTETEXTUREZONESB ruceRedFreestonePollinator FreePollinator SweetFirm5-9 MorrisRedSemi FreePollinator RosaAmberSemi FreePollinator - 5 + COCKTAILPRICESNECTARINEVARIETYFLESH COLORSTONE FREENESSPOLLINATORTASTETEXTUREZONESK arla RoseWhiteFreestoneSelf FertileSweetFirm5-9 June PrincessYellowFreestoneSelf FertileVery SweetFirm5-8 Rose PrincessWhiteFreestoneSelf FertileVery SweetFirm5-8 DESCRIPTION7 FLOWERING TREESFLOWERING CHERRYQty3-4 4-5 5-6 5-6 Branched5-6 Weeping6-8 Branched8-10 + COLORHABITHEIGHTZONESK wanzanPinkUpright, Vase Shaped20-25'5-9 OkamePinkUpright, Vase Shaped20-25'5-9 YoshinoWhiteRound25-30'5-8 Yoshino, WeepingPinkCascading8'5-8 DESCRIPTIONVARIETYHABITHEIGHTZONESC levelandUpright, Vase Shaped15-20'5-8 BradfordOval15-20'5-8 AristocratUpright.

4 Vase Shaped15-20'4-8 DESCRIPTIONFLOWERING PEARQty3-4 4-5 5-6 5-6 Branched6-8 Branched8-10 + TREESCRABAPPLEP rofusion (Pink), Adams (Pink), & Dolgo (White)all budded on one tree for a beautiful splash of pink & white habit, height 15-25' tall. Zones 4-8 DESCRIPTIONVARIETYBLOOM COLORHABITHEIGHTZONESROYALTYA damsPinkRound15-25'4-6 CallawayWhiteRound15-25'5-8 DolgoWhiteRound15-20'3-9 ProfusionPinkRound15-30'4-8 Red Jade, WpgWhiteDwarf/Weeping12-15'4-8 RobinsonRedRound15-20'4-8 Showtime RedUpward-Wide15-20'4-8$ COLOR CRABAPPLEQty3 - 4 4-5 Branched5-6 + 4-5 5-6 5-6 Branched6-8 Branched8-10 + TREESREDBUDVARIETY BLOOM COLORFOLIAGEHEIGHTZONEE asternPink-PurpleDark Green, Heart Shaped15-20 ft4-9 Forest PansyRosy-PinkBurgundy, Heart Shaped15-20 ft5-9 Hearts of Gold pp# 17,740 LavenderGold/Green, Heart Shaped15-20 ft5-9 Lavender Twist WeepingRosy-PinkDark Green, Heart Shaped6 ft5-9pp# 10,328 MerlotPinkBurgundy, Glossy15-20 ft6-9pp# 22,297 Rising Sun LavenderLight Green/Apricot, Heart Shaped15-20 ft5-9 Ruby Falls WeepingRedish-PurpleBurgundy, Heart Shaped6 ft5-9pp# 22.

5 097 DESCRIPTION2 YR 3-4'2 YR 4-5'2 YR 5-6'3 YR 4'3 YR 5'3 YR 6'WhipLight BRLight BRHeavy Br Heavy BrHeavy of Gold * Twist * Sun * * Hearts of Gold add $ ea royalty and Rising Sun & Merlot add $ ea royaltyPRICES10 FLOWERING TREESPATIO PEACHWEEPING PEACHPink Cascade weeping peach. Double rose-pink 12-15 ft. Zones 5-8 Qty6 + COLORHABITHEIGHTZONESB onanzaRedDense,Dwarf5-8'6-9 BonfireDark PinkDense,Dwarf5-8'5-9 Qty3 -4 + TREESFLOWERING PLUMQty3 - 4 4 - 5 5 - 6 + COLORHABITHEIGHTZONESK rauter Vesuvius (KV)PinkDense, Upright15-20'4-8 NewportPinkOval15-20'4-8 DESCRIPTION12 NOTESD aniell The Printer, Inc. (931) 967-2704