Example: quiz answers

THE TOWER - St. John's, Manchester

THE TOWERST. JOHN S PLACELIVING LANDMARK02ST. JOHN S5 2 STOREYS04ST. JOHN S06ST. JOHN STIMELESS CLASSIC11ST. JOHN SSTARK ELEGANCESTARK ELEGANCET aking inspiration from the first towers in New York and Chicago, our brief was to create a classic piece of architecture that instils a sense of heritage. We carefully studied the way in which those towers from the 1930 s through to the 60 s were designed, taking taking particular note of the form and style. INSPIREDCHICAGONEW YORKLeft - The 52 storey Union Carbide Building. 270 Park Avenue between Park and Madison Avenue and 47th 48th Streets. Far Left - Lever House, located at 390 Park Avenue in Midtown Manhattan. 47th 48th Streets. Left - One Chase Manhattan Plaza, a banking skyscraper located in the downtown Manhattan Financial District of New York City, between Pine, Liberty, Nassau, and William - The 52 storey Union Carbide Building.

30 ST. JOHN’S St. John’s Place will also be home to Nadler at The Tower, a 160 room luxury hotel with rooms and suites from the 1st to 15th floor of

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of THE TOWER - St. John's, Manchester

1 THE TOWERST. JOHN S PLACELIVING LANDMARK02ST. JOHN S5 2 STOREYS04ST. JOHN S06ST. JOHN STIMELESS CLASSIC11ST. JOHN SSTARK ELEGANCESTARK ELEGANCET aking inspiration from the first towers in New York and Chicago, our brief was to create a classic piece of architecture that instils a sense of heritage. We carefully studied the way in which those towers from the 1930 s through to the 60 s were designed, taking taking particular note of the form and style. INSPIREDCHICAGONEW YORKLeft - The 52 storey Union Carbide Building. 270 Park Avenue between Park and Madison Avenue and 47th 48th Streets. Far Left - Lever House, located at 390 Park Avenue in Midtown Manhattan. 47th 48th Streets. Left - One Chase Manhattan Plaza, a banking skyscraper located in the downtown Manhattan Financial District of New York City, between Pine, Liberty, Nassau, and William - The 52 storey Union Carbide Building.

2 270 Park Avenue between Park and Madison Avenue and 47th 48th Streets. Far Right - Lever House, located at 390 Park Avenue in Midtown Manhattan. 47th 48th Streets. Right - The 100 storey John Hancock Center, the world s first mixed-use TOWER on 875 North Michigan Avenue. ANARCHITECTURALSTATEMENTThe TOWER at St. John s Place will become a new living landmark for Manchester . Sitting 52 storeys high, it will become the largest storey building in Manchester . Not only will The TOWER be breathtaking in size but also elegant in its finer JOHN STHE GATEWAYTO ST. JOHN SMANCHESTER GOODS YARDBONDED WAREHOUSESOUTH VILLAGEOLD GRANADA STUDIOSFACTORYNICKEL & DIMETHE TOWERGLOBE & SIMPSONALBERT LOFTSARTSINNOVATIONA place where enterprise will flourish alongside arts and the mould and pioneering the way for place to meet, create and many, a choice to buy, to rent, to invest, to live.

3 A lifestyle choice throughout the neighbourhood of villages and opportunity not to be missed, to invest in whatwill be one of the UK s most carefully crafted andconsidered investment completion, Allied London s St. John s neighbourhood will include three new hotels, some 2,500 residential dwellings, four cultural destinations, restaurants, retail stores, caf s, and 420,000 sq ft of innovative enterprise workspaces. Allied London is already engaging with occupiers and operators in all of these sectors and anticipates a significant number having been secured by the time phased construction is due to start in 2017. In addition, St. John s will be home to Factory. A 110m cultural building for the North including classical opera and ballet to large-scale performances and experimental JOHN S PLACENEIGHBOURHOOD24ST. JOHN SCASTLEFIELDSPINNINGFIELDSM A N C U N I O N W A YANCOATSARDWICKALBERTSQUAREMANCHESTERARN DALE PICCADILLYGARDENSPICCADILLYSALFORDCENTRA LSTATIONNORTHERNQUARTERGAY VILLAGECHINATOWNL O N D O N R O A DG R E A T A N C O A T SS W A N S T R E E TM I L L E R S T R E E TA Y T O U N R O A DO X F O R D R O A DO X F O R D S T R E E TP O R T L A N D S T R E E TG R E A T B R I D G E W A T E R S T R E E TN E W T O N S T R E E TO L D H A M S T R E E TL E V E R S T R E E TP E T E R S T R E E TD E A N S G A T ED E A N S G A T EC R O S S S T R E E TQ U A Y S T R E E TL I V E R P O O L R O A DP R I N C E S S S T R E E TS A C K V I L L E S T R E E TS T O R E S T R E E TC H O R L T O N S T R E E TPARSONAGEGARDENSCENTRALLIBRARYMANCHESTE RCENTRALST PETERS SQUAREDEANSGATE /CASTLEFIELDPICCADILLYGARDENSMARKET

4 STREETSHUDEHILLGREAT NORTHERN WAREHOUSEBEETHAM TOWERNATIONAL FOOTBALL MUSEUMMOSIHOMEKAMPUSTOWN HALLM A R K E T S T R E E TST. JOHN SGARDENSSACKVILLEGARDENSJ O H N D A L T O N S TB R I D G E S T R E E TP R I N C E S S S T R E E TF A I R F I E L D S T R E E TW H I T W O R T H S T W E S TW H I T W O R T H S T R E E TOXFORDROADSTATIONDEANSGATESTATIONVICTOR IASTATIONPICCADILLYSTATIONTHE TOWERST. JOHN SSPINNINGFIELDS5 mins10 mins15 m i n s20 minsLIFE IN THE TOWER29ST. JOHN SHOMES INTHE SKYL iving in The TOWER at St. John s will contain all of the luxury you d expect from a house. We are creating homes in the sky. A place you relish coming back to after a hard day s work. Residents at The TOWER will enjoy first-class concierge services, parking, open green spaces and rooftop JOHN SSt. John s Place will also be home to Nadler at The TOWER , a 160 room luxury hotel with rooms and suites from the 1st to 15th floor of The at The TOWER will offer extensive spa and fitness facilites, exclusive signature restaurants and bars with breathtaking city views, along with proactive and personalised customer are an internationally acclaimed, smart, boutique hotel brand from London s Soho district and are regarded as having the best suite of hotels in London.

5 They are rated in the top 12 of all London hotels, and we are proud to welcome them to the first 15 floors of The JOHN SWELLBEINGRELAXATIONFINE DININGACCLAIMEDSPACIOUSON THEGROUNDThe ground level of The TOWER at St. John s Place will be a hub of activity with areas to grab a coffee in the morning, private residential gardens to escape and unwind with wellbeing activities, carefully curated public realm gardens and spaces to JOHN SDETAILSARE NOT THE MAKE THE DESIGN37ST. JOHN SON THEGROUND38ST. JOHN S40ST. JOHN SLIVINGROOMThe focal point of the apartment, with iconic furniture and contemporary & Media Freeview digital TV and broadband, also satellite TV and broadband infrastructure has been installed in each apartment to enable the occupiers to obtain these services from their preferred service provider. Telephone outlets to living room spaces and the master layout with dining connecting withthe living room space.

6 Beautiful, durable, qualitymaterials in practical and innovative applications. Fitted kitchens with bespoke fibre cement doors. Marble worktops. Vado contemporary satin brass mixer tap. Siemens integrated fridge/freezer, dishwasher, ceramic hob, oven and concealed extractor hood. Inset stainless steel sinks . Domus large format marble porcelain tile splashback. Buster + Punch antique brass door knobs. Integrated waste recycling bin compartments. Under cupboard lights Sensio Genus JOHN SKITCHEN45ST. JOHN SBEDROOML uxurious and simple design of layouts, fabrics and JOHN SBATHROOMH andsome materials, beautifully detailed. Duravit white porcelain sanitaryware to include bath, WC and basin. Thermostatic mixer bath/shower tap with high quality wallmounted shower head and rail with glass showerscreen.

7 Full width mirror. Chrome heated towel rail. Stainless steel shaver socket. Chrome mounted toilet roll holder. Chrome mounted coat hook. Large format marble effect porcelain tiles to shower walls and backsplash. Grestec Coastal Collection decorative tiles to accent walls. En suites will include a shower with fixed frameless shower screen and thermostatic mixer shower tap with high quality wall mounted shower head and JOHN SFIXTURES &FITTINGSE legant and minimal expression of materialsand detail interfaces. Brushed stainless steel power and socket range throughout internally. Full height windows and patio doors throughout. Oiled oak herringbone pattern flooring to kitchen and lounge areas. Broadloom carpet to bedrooms. Ceramic tiles to bathrooms and ensuites. Vinyl floor to utility/storage JOHN SHEATING &LIGHTING Underfloor heating throughout Down lighters to kitchens, bathrooms and en-suites fitted with low energy lamps and pendants to living spaces and bedrooms Mechanical extract ventilation is provided to all kitchen, bathroom and WC JOHN SGREENSPACESACCESSIBILITYR esidents of The TOWER at St.

8 John s Place are provided with high quality, luxurious communal gardens, which are secure and private. They are sheltered by a three storey high overhang in the building and are designed as a series of outdoor rooms. The space is unified through the strips of planting that run through and create a connection to the public space beyond. The soft landscape is carefully considered and will be high quality public realm and pedestrian friendly, traffic calmed access routes around the site will provide safe and convenient links to the surrounding areas. Potential users and visitors, regardless of age, gender or any disabilities are able to access and navigate unimpeded through all appropriate areas of each building and surrounding public realm. The internal building environment can be successfully and safely used by all of the potential users of the building.

9 Every opportunity will be taken to utilise colour, textures, materials and treatment of space to assist with the overall legibility and aesthetic value of the setting out of the building levels has been dictated by the existing pavement levels. With this in mind the design ensures that all primary entrances can be accessed from flat and level approaches. A secure car parking facility is available for residents to use. Residents can pay on an annual basis to use this facility. Cycling is promoted as part of the St. John s masterplan strategy. A proposed cycle hub facility will offer cycle parking, lockers and changing facilities for visitors and those not allocated a cycle parking space. It will also offer a cycle hire facility on a short and long term hire JOHN SSUSTAINABILITYREFUSE & RECYCLINGThe approach which has informed the energy strategy of the proposed development has been to reduce demand where possible before considering how best to supply it.

10 This means first identifying where energy demand can be eliminated and then how it can be used more efficiently. Residential areas will look to achieve at least a 19% reduction over current standards. Renewable energy on site is proposed to be provided by the district CHP system provided as part of the wider St. John s masterplan, with heating, hot water and electricity all provided via this low carbon source. The renewable energy strategy has been arrived at as part of a greater masterplanning exercise, which has considered all forms of renewable energy suitable for the site. At least 25% of the final building energy demand will be met by these low or zero carbon energy separate waste and servicing strategy has been developed which provides full details of the proposed strategy. Three laybys are proposed along Water Street for delivery vehicles to pull up.


Related search queries