Example: bachelor of science

FESCO Board

FESCO BoardPerlite-Based Cover BoardRefer to the Safety Data Sheet and product label prior to using this product. The Safety Data Sheet is available by calling (800) 922-5922 or on the Web at and the EnvironmentLEED Recycled Content32% averageFor post and pre-consumer recycled content percentages, visit the FESCO Board product page on the JM roofing Web 3 25 PSI Insulation Boardcontains an average of 34% recycled Advantage Guarantee InformationSystemsGuarantee Term*When used in most 2-5 ply BUR and SBS ,15 or 20 years* Contact JM Technical Services for specific systems or terms over 20 and ApprovalsInstallation/ApplicationMechani callyFastenedUrethaneAdhesiveUUretthhane Hot AsphaltCold AppliedRefer to the Application Guides and Detail Drawings for and DimensionsSize2' x 4' ( m x m)

FESCO ® Board Perlite-Based Cover Board Meets the requirements of ASTM C 728, Type 1 Typical Physical Properties Test ASTM Fesco Board Strength Board Density, pcf (kg/m3), min C 209 8 (128) Compressive Strength 5% Consolidation, psi (kPa), nom C 165 30 (207) Laminar Tensile Strength, psi (kPa), nom C 209 8 (55) Flexural Strength, psi (kPa), nom C 203 65 (448)

Tags:

  Reptiles

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Transcription of FESCO Board

1 FESCO BoardPerlite-Based Cover BoardRefer to the Safety Data Sheet and product label prior to using this product. The Safety Data Sheet is available by calling (800) 922-5922 or on the Web at and the EnvironmentLEED Recycled Content32% averageFor post and pre-consumer recycled content percentages, visit the FESCO Board product page on the JM roofing Web 3 25 PSI Insulation Boardcontains an average of 34% recycled Advantage Guarantee InformationSystemsGuarantee Term*When used in most 2-5 ply BUR and SBS ,15 or 20 years* Contact JM Technical Services for specific systems or terms over 20 and ApprovalsInstallation/ApplicationMechani callyFastenedUrethaneAdhesiveUUretthhane Hot AsphaltCold AppliedRefer to the Application Guides and Detail Drawings for and DimensionsSize2' x 4' ( m x m)

2 Thickness* " ( cm)1" ( cm)1 " ( cm)2" ( cm) Board Weight (lb)671215Ft2/Bundle96804840 Boards/Bundle121065 Bundles/Pallet10101010 Pallet Weight (lb)715740715740 Pallets per Truck*48 Size4' x 4' ( m x m)Thickness* " ( cm)1" ( cm)1 " ( cm)2" ( cm) Board Weight (lb)12152430Ft2/Pallet960800480400 Boards/Pallet60503025 Pallet Weight (lb)715735715735 Pallets per Truck**48 Producing LocationRockdale, IL* and 1 thicknesses are homogenous, 1 " and 2 thicknesses are laminated** Assumes 48 flatbed 6-18 (Replaces 8-16)Meets the requirements of ASTM C 728, Type 1 Features and ComponentsTopLoc Coating: Top surface is sealed with this special coating to reduce excessive asphalt absorption in hot-asphalt applied roofing systems.

3 Expanded Perlite: Provides good dimensional stability, excellent insulation value with stable R-value and fire Thermal Insulation Board : Composed of expanded perlite, reinforcing cellulosic fibers and selected binders. Reinforcing Cellulosic Fibers: Consists of recycled newsprint to provide strength to the Board as well as high recycled content. JM utilizes third party certification by UL Environment to certify the recycled content and contributes to the LEED Materials and Resource (MR) credit Asphalt Friendly: Protective cover Board or low thermal insulation Board proven to reduce the tendency for blistering in hot asphalt Compatibility This product may be used as a component in the following systems. Please reference product application for specific installation methods and information.

4 Multi-PlyBURAPPSBSS ingle PlyTPOPVCEPDMHACACAHWHACAHWSAMFMFADSAMFA DMFADBAC ompatible with the selected Multi-Ply systems aboveDo not use with Single Ply systemsKey: HA = Hot Applied CA = Cold Applied HW = Heat Weldable SA = Self Adhered MF = Mechanically Fastened AD = Adhered BA = BallastedComponentTypePL PerliteLT Low ThermalB Cover BoardMulti-PlyFESCO BoardPerlite-Based Cover BoardMeets the requirements of ASTM C 728, Type 1 Typical Physical Properties TestASTMF esco BoardStrengthBoard Density, pcf (kg/m3), minC 2098 (128)Compressive Strength 5% Consolidation, psi (kPa), nomC 165 30 (207)Laminar Tensile Strength, psi (kPa), nomC 2098 (55)Flexural Strength, psi (kPa), nomC 20365 (448)Break Load, lbs, nomC 2039 ( in.)

5 , 13 (1 in.), 23 (1 in.)MoistureMoisture Content, wt%, Absorption, % by vol, maxC Expansion, %, maxC Span, in. (thickness), maxE 6611 ( in.), (1 in.), (1 in.)Weight per ft2, lbs (thickness), ( "), 1 (1"), (1 "), (2")Thermal PerformanceThickness in. mmR-Value (Resistance) (hr ft2 F)/BTU m2 C/W 19 1 25 1 38 2 51 BoardFlame SpreadE 8425 Smoke DevelopedE 8410RS-5010 6-18 (Replaces 8-16)Refer to the Safety Data Sheet and product label prior to using this product.

6 The Safety Data Sheet is available by calling (800) 922-5922 or on the Web at


Related search queries