Example: air traffic controller

IWAKI Metering Pump

Read this manual before use of productIWAKI Metering PumpLK-F SeriesInstruction ManualT268-4 '03 : (49)2154 9254 0 TEL : (39)02 990 3931 TEL : (45)48 24 2345 TEL : (46)8 511 72900 TEL : (358)9 2742714 TEL : (47)66 81 16 60 TEL : (33)1 69 63 33 70 TEL : (44)1743 231363 TEL : (41)26 674 9300 TEL : (43)2236 33469 TEL : (31)297 241121 TEL : (34)943 630030 TEL : (32)1367 KongChinaChinaChinaChinaPhilippinesKorea TEL : (1)508 429 1440 TEL : (61)2 9899 2411 TEL : (65)6763 2744 TEL : (62)21 690 6606 TEL : (60)3 7803 8807 TEL : (886)2 8227 6900 TEL : (66)2 322 2471 TEL : (852)2 607 1168 TEL : (86)750 380 9018 TEL : (86)20 8435 0603 TEL : (86)10 6442 7713 TEL : (86)21 6272 7502 TEL : (63)2 888 0245 TEL : (82)2 3474 0523: IWAKI EUROPE GmbH: IWAKI Italia : IWAKI Pumper A/S: IWAKI Sverige AB: IWAKI Suomi Oy: IWAKI Norge AS: IWAKI France : IWAKI pumps (UK) LTD.

- 1 - IMPORTANT INSTRUCTIONS Important notes and statements for safe operation, preventing physical injury, and property damage, are included on the body of …

Tags:

  Pumps, Metering, Iwaki metering pump, Iwaki

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of IWAKI Metering Pump

1 Read this manual before use of productIWAKI Metering PumpLK-F SeriesInstruction ManualT268-4 '03 : (49)2154 9254 0 TEL : (39)02 990 3931 TEL : (45)48 24 2345 TEL : (46)8 511 72900 TEL : (358)9 2742714 TEL : (47)66 81 16 60 TEL : (33)1 69 63 33 70 TEL : (44)1743 231363 TEL : (41)26 674 9300 TEL : (43)2236 33469 TEL : (31)297 241121 TEL : (34)943 630030 TEL : (32)1367 KongChinaChinaChinaChinaPhilippinesKorea TEL : (1)508 429 1440 TEL : (61)2 9899 2411 TEL : (65)6763 2744 TEL : (62)21 690 6606 TEL : (60)3 7803 8807 TEL : (886)2 8227 6900 TEL : (66)2 322 2471 TEL : (852)2 607 1168 TEL : (86)750 380 9018 TEL : (86)20 8435 0603 TEL : (86)10 6442 7713 TEL : (86)21 6272 7502 TEL : (63)2 888 0245 TEL : (82)2 3474 0523: IWAKI EUROPE GmbH: IWAKI Italia : IWAKI Pumper A/S: IWAKI Sverige AB: IWAKI Suomi Oy: IWAKI Norge AS: IWAKI France : IWAKI pumps (UK) LTD.

2 : IWAKI (Schweiz) AG: IWAKI (Austria) GmbH: IWAKI Holland : IWAKI Iberica pumps , : IWAKI Belgium : 2154 1028 FAX : 02 990 42888 FAX : 48 24 2346 FAX : 8 511 72922 FAX : 9 2742715 FAX : 66 81 16 61 FAX : 1 64 49 92 73 FAX : 1743 366507 FAX : 26 674 9302 FAX : 2236 33469 FAX : 297 273902 FAX : 943 628799 FAX : 1367 2030: IWAKI WALCHEM Corporation: IWAKI pumps Australia Pty. Ltd.: IWAKI Singapore Pte. Ltd.: IWAKI Singapore (Indonesia Branch): IWAKIm Sdn. Bhd.: IWAKI pumps Taiwan Co., Ltd.: IWAKI (Thailand) Co.,Ltd.: IWAKI pumps Co., Ltd.: IWAKI pumps (Guandong) Co., Ltd.: GFTZ IWAKI Engineering & Trading (Guangzhou): IWAKI pumps Co., Ltd. (Beijing): IWAKI pumps (Shanghai) Co., Ltd.: IWAKI Chemical pumps Philippines, Inc.: IWAKI Korea Co., : 508 429 1386 FAX : 2 9899 2421 FAX : 6763 2372 FAX : 21 690 6612 FAX : 3 7803 4800 FAX : 2 8227 6818 FAX : 2 322 2477 FAX : 2 607 1000 FAX : 750 380 9078 FAX : 20 8435 9181 FAX : 10 6442 7712 FAX : 21 6272 6929 FAX : 2 843 3096 FAX : 2 3474 0221( )Country codesIWAKI CO.

3 , Kanda-Sudacho 2-chome Chiyoda-ku Tokyo 101-8558 JapanTEL:(81)3 3254 2935 FAX:3 3252 8892( )Thank you for selecting the IWAKI Mechanical-driven Diaphragm Type Metering Pumpmodel LK-F. This instruction manual has been prepared to ensure correct and safe handlingof the pump. Please read this manual carefully and thoroughly prior to operating the special attention to the "Safety Instruction to Prevent Personal Injuries," "Warning," and"Caution" messages included in this instruction manual should be kept by each end user and within reach of the actualoperator, for quick reference when INSTRUCTIONS ..1 Safety Instructions to Prevent Personal InjuriesOUTLINE OF Before Using Pump ..52. Operating Principle ..53. Identification Codes ..64. Specifications and Outer Dimensions ..75. Description on Main Unit and Lavel ..20 PUMP OPERATION.

4 211. Handling Instructions ..222. Installation ..243. Piping ..254. Wiring ..275. Operation Step ..27 MAINTENANCE ..311. Causes of Trouble and Maintenance and Inspection ..343. Consumable Parts ..354. Disassembly and Assembly ..36 Please contact the IWAKI sales office or IWAKI dealer for any inquiriesor questions regarding this 1 -IMPORTANT INSTRUCTIONSI mportant notes and statements for safe operation, preventing physical injury, and property damage,are included on the body of the product and in the attached instruction Observe These Safety Instructions!Safety Instruction to Prevent Personal InjuriesIn this manual, the following symbols and signs are used to clearly indicate safety of SymbolsIndicates that "Warning" or "Caution" must be exercised. Inside this tri-angle, a concrete and practical image provided as a warning or cautionmessage is a prohibited action or procedure.

5 Inside or near this circle, aconcrete and practical image of the activity to be avoided is an important action or procedure which must be performed orcarried out without fail. Failure to follow the instructions herein can leadto malfunction or damage to the or misapplication of thecontents of the "Warning" section couldlead to a serious accident, including deathor or misapplication of thecontents of the "Caution" section couldlead to serious physical injury to the useror serious damage to the product.(Always read and observe the followinginstructions to prevent personal injuries.)- 2 -lDamaged or deteriorated tools are very qualified and suitable tools of protectors:When disassembling, assembling, and conducting maintenance or whenhandling a dangerous type of liquid or a liquid of unknown property, be sure to wear safety gloves, ahelmet, and protective shoes.

6 In addition, when handling wet-end parts, always wear protective goggles,masks, prevent death or injury from a falling pump,make sure the rope or chain used for liftingthe pump is not accidentally cut or disconnected during installation. Make sure the rope or the chainused to lift the pump has sufficient strength in relation to the pump load. Also, be sure not to standunderneath a lifted or suspended turn off the power supply prior to servicing the pump. Make special provisionsso that no other operator mistakenly turns on the power supply while someone is working on the a noisy or poor visibility environment, display a sign near the power supply switch to notify others thatsomeone is "WORKING" on the pump. Power supply mistakenly turned on during maintenance maylead to personal injury. Each operator must be especially careful of power supply ensure greater safety, check and make sure that there is no one near thepump when switching on the power pump is not equipped with an ON/OFFswitch.

7 Connecting the power cable or power plug supplies the power to the pump and starts the pump at the specified power supply voltage on the nameplate , fire or electric shock may the pump operation is stopped due to a power failure or closure of dischargelire,turn off the power switch at once. After normal conditions return, turn the switch on not use the pump for anything that it is not designed to s failure toobserve this instruction exempts IWAKI from any responsibility for personal injury or damage to theequipment or facility caused by the pump s handling a toxic or odorant liquid, ventilate the working area well. In addition, theoperator must wear protector gear (such as a safety mask, safety goggles, and protective gloves).lDo not allow toxic substances such as lubricants, solvents, or similarsubstances to flow into the local sewage system or river not drainhazardous liquids such as chemical solutions discharged out of the pump directly onto the , drain such liquids into some kind of container.

8 Observe the laws and regulations related to theapplication, handling, and processing of hazardous (Always read and observe the followinginstructions to prevent personal injuries.)- 3 -CautionlWear gloves when working with rope or chain. Working with bare hands mayresult in serious injury, since fingers are likely to be caught between the pumpand the rope or chain when the rope or chain is under strong pump is not designed to be used under water. Operate the pump on in-linemode a safety valve on the discharge not close any discharge or suction valve while in 4 -OUTLINE OF PRODUCT1. Before Using 52. Operating Principle .. 53. Identification Codes .. 64. Specifications and Outer Dimensions .. 75. Description on Main Unit and Lavel .. 20- 5 -1. Before Using PumpAfter unpacking, check the following points to confirm thatthe delivered product its accompanying parts and elementsare exactly what you ordered.

9 When lifting the pump please follow the procedurementioned "2. Installation" of "pump operation".[1] Do the model and frequency indicated on the nameplateconform to your order? [2] Has the pump unit or any part of it been damaged orbolts and nuts been loosened during delivery?If you find anything wrong, please refer to the dealer youplaced your order rotation of the motor is reduced by means of the wormand wheel. The rotary motion is changed to a reciprocatingmotion by the spring-back mechanism (including the wormwheel shaft, slider, spring, etc.). The reciprocating motionis transmitted to the diaphragm directly connected with theshaft, changing the volume inside the pump chamber. Thus,variation of the volume inside the pump chamber and thefunctioning of the valves in the pump head produce adjusting the stroke length, the adjusting dial fixed onthe control shaft is rotated to change the return of the Operating PrincipleMODEL1P411712 IWAKI CO.

10 , JAPANI wakiMetering PumpMAX. CAPACITYR/minMAX. PRESSUREMPaSTROKE RATEspmFREQUENCY50 60 HzMFG. wheel shaftSliderDialControl shaftSpringShaft- 6 -3. Identification CodesExample:LK-F31 VCH 02 FESqwer tyuiqSeriesLK-F Type SerieswType symbolRefer to 4. Specifications and Outer Dimensions on : Flange (JIS)U: UnionH: HoseuServo unitE: with electric servo unitiSpecial symbolS: Special specification other than standardeMaterial symbolRefer to the material table on page7.(ex. VC, VH, VS, S6,)tMotor output02: motorF: Inverter motor(Note) General-purpose motors have no 7 -nStandard MaterialMaterial symbolpartPump headValve vallValveseatType 11 to 32 Type 45 to 57O ringValve gasketDiaphragmVCVHVSS6 PVCCEFKMPVCFKMPVCHCEPDMPVCEPDMPVCHC/SUS3 04 SUS304 SUS304 EPDMSUS316 HCSUS316 SUS316 PTFEPTFE PTFE+EPDMCE:Alumina ceramicsHC:Hastelloy C267(Note) For the actual names of the parts, refer to a paragraph which deals with the limitMPaStroke speedspmConnectionLK-F *SUS *PVC *Flange (Nominal dia)SUS *1 PVC * 15A(VH, VC, VS)JIS10K 25A(LK-47VS)JIS16K 15 AVP16VP25(LK-47VS) JIS10K* PVC refers to the material symbols VC, VH, or VS while SUS refers to the material symbol S6.


Related search queries