Utility Pipe FiRAings and Accessories Flanged Fittings

1 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX : Ductile iron per ASTM A536 PRESSURE: 250 PSI ratiing for 1" - 48" sizes and 150 PSI rating for 54" - 64"TESTING: In accordance with ANSI/AWWA C110 , UL and FM requirementsLAYING LENGTH: 2" - 48" sizes in accordance with ANSI/AWWA C110 and ANSI and 54" - 64" sizes in accordance with ANSI/AWWA C153 ( Fittings not listed in ANSI/AWWA have dimensions per Star design as noted in the catalog)WEIGHTS: Are in pounds, unless noted otherwise and do not include Accessories , cement lining and coatingsDRILLING: In accordance with ANSI/AWWA C110 , ANSI/AWWA C153 and ANSI Class 125 FlangesCEMENT LINING: In accordance with ANSI/AWWA C104 -- size 1" - 3" single thickness and sizes 4" - 64" double thickness.

2 Click here for a pressure jetting discussion or visit COATING: Asphaltic seal coat inside in accordance with ANSI/AWWA C104 and prime coat outsideAPPROVALS: 2" - 12" Underwriters Laboratories and ULC Listed and Factory Mutual approved for 300 PSI rating. Please consult factory for detail listing and approvals. 3" and greater are UL/ANSI/NSF Standards 61 and 372. DIMENSIONS: All dimensions are in inches unless noted : Per ANSI/AWWA C110 and C111 GENERAL SPECIFICATIONS1" - 64" DUCTILE IRON Flanged Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 DETAILSNOM. OLT x 241 x x 2 42 x 2 x 2 x x x 3 x 3 x x x 4 x 4 x x x 5 x 6 x x 7 x x 8 x x 952 APPROVEDMEMBERPage 40 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX FittingsOutletReducing onReducing onOne RunReducing on One Run and OutletReducing on BothRuns (Bull Head)

3 Reducing CrossesacbbcacabcabReducing TeescbadReducing onOne OutletReducing oncaBoth OutletsbdReducing oncaOne Run and Outletbdand Both OutletsReducing on One RuncabdReducing LateralsabcReducing onBranchReducing onOne RunacbOne Run and BranchReducing onacbbcaTrue YSide Outlet TeeDouble BranchElbowSide Outlet 90 deg. ElbowRight HandbadcbdLeft HandbbacacbRight HandLeft HandcacaMETHOD OF DESIGNATING OUTLETS OF REDUCING Fittings FOR SPECIFICATIONSThe largest opening establishes the basic size of a reducing fitting . The largest opening is named first, except for bull head tees which are reducing on both runs and double branch elbows where both branches are reducing; the outlet is the largest opening and named last in both designating the opening of reducing Fittings , they should be read in order indicated by the sequence of the letters a, b, c and d.

4 In designating the outlets of side outlet of side outlet reducing Fittings , the side outlet is named last; and in the case of the cross which is not shown, the side outlet is designated by the letter e. Utility Pipe FiRAings and AccessoriesANSI/AWWA C110 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings90 deg. ElbowStraight Size90 deg. ElbowTeeStraight SizeStraight SizeCross90 deg. ElbowReducing SizeReducing SizeTeeReducing SizeCrossSide Outlet 90 deg. ElbowStraight SizeFront ViewSide ViewFront ViewSide ViewStraight SizeSide Outlet Tee45 Deg. LateralStraight and ReducingStraight and Reducing90 Deg. Base ElbowBase TeeDouble Branch ElbowTrue Y45 Deg.

5 ElbowReducerEccentric ReducerRREYGFTTNMKYSEGHFRSTTRSMKNLEJHGFL MPNKREGFYTVTYVRHREGSTFRSTNMKLHEGJFLMNPKR EGFTYVVGFTYKWHEGSRTFHGFTKRSEHRGSFTRSTMLK NGERFRKMNFTTTRHGEKMLNRTRTHERTKLFNEHGFLKM NGEFRSTRSTGFHMNKFGHTRSXYZRSTZYXNMKNMKNMK METHOD OF DESIGNATING LOCATION OF TAPPED HOLESFOR DRAINS WHEN SPECIFIEDThe above illustrations show two views of the same fitting and represent Fittings with symmetrical shapes, with the exception of the side outlet elbow and the side outlet tee (straight sizes) Utility Pipe FiRAings and AccessoriesANSI/AWWA C110 SIZEMAX TAP SIZEWITHOUT BOSS3 4-6 81 10-161 18-642 Page 42 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 BENDS90 Flanged BENDS ( )45 Flanged BENDS ( )22 Flanged BENDS ()11 Flanged BENDS () (LBS.)

6 ARWT(LBS.)ARWT(LBS.)ARWT(LBS.) Flanged LONG RADIUS (LBS.) FLANGE x FLARE (LBS.) REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 FLANGE x FLARE (LBS.) HOLE (LBS.) Flanged LONG RADIUS BASE BENDS & BASE TEESBASE DRILLING DETAILSNOM. SIZERSTUWT. (LBS.) OFB OLT S90 90 44 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 Flanged REDUCING (LBS.)3 x 1 x x 2 x x 2 x x x 2 x x x x 2 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x Flanged REDUCING BENDS (C on t) (LBS.)

7 20 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x (C o n t) REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 Flanged REDUCING BASE (LBS.)4 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x Flanged REDUCING BASE BENDS (C on t) (LBS.)24 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x UnderLarge EndBase UnderSmall EndBase Drilling Detail on pg.

8 43 SUTR2 USTR1 Page 46 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 TEES & CROSSESNOM. SIZETT1T2 HJWT. (LBS.)TEECROSS1 x 1 x x 1 x 1 x x 2 x x 2 x 2 x x 1 x 2 x x 1 x x 2 x x 3 x x x 2 x x 2 x 2 x x x x 4 x x 4 x x 2 x x x 5 x x 3 x 3 x 3 x x 4 x x 4 x x 4 x x 5 x 2 x 5 x x 5 x x x 2 x x x x x 6 x x 4 x x 5 x x 6 x x 6 x TEES & CROSSES (C on t)NOM. SIZETT1T2 HJWT. (LBS.)TEECROSS8 x 6 x x 2 x x x x x x 8 x x 8 x x 4 x x 6 x x 6 x x 6 x x 8 x x 8 x x 8 x x x x x x x x x 10 x x 10 x x 6 x x 6 x x 8 x x 8 x x 8 x x 10 x x 10 x x 10 x x 10 x x x x x x 10 x x x (C o n t) (C o n t) REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 TEES & CROSSES (C on t)NOM.

9 SIZETT1T2 HJWT. (LBS.)TEECROSS14 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 24 x x x x 30 x TEES & CROSSES (C on t)NOM. SIZETT1T2 HJWT. (LBS.)TEECROSS36 x 36 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x TRUE (LBS.)3 x 3 x 3 x 4 x x 4 x x 6 x x 6 x x 8 x x 8 x x 12 x x 16 x (C o n t) Page 48 REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 WYE (LBS.)

10 3 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x WYE LATERALS (C on t) (LBS.)24 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 30 x C110 (C o n t) REGISTERED TRADEMARK OF STAR PIPE PRODUCTSS TA R PIPE PRODUCTSHOUSTON CORPORATE TOLL FREE 1-800-999-3009 FAX Fittings Utility Pipe Fittings and AccessoriesANSI/AWWA C110 CONCENTRIC & ECCENTRIC (LBS.)2 x 1 x x x 2 x x 2 x x x 2 x x x 1 x x 2 x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x CONCENTRIC & ECCENTRIC REDUCERS (C on t) (LBS.)