Example: confidence

Guidance for Clinicians

Guidance for Clinicians Caring for Patients after a Tick BiteWhen a patient seeks care after a tick bite, topics to discuss should include: Tick removalLyme disease prophylaxisSymptom watch How to Remove a TickUse fine-tipped tweezers to grasp the tick as close to the skin s surface as upward with steady, even pressure. Don t twist or jerk the removing the tick, thoroughly clean the bite area and your hands with rubbing alcohol or soap and a live tick by putting it in rubbing alcohol or placing it in a sealed bag/container. Save the tick for species identification and degree of tick engorgement (important when determining eligibility for lyme disease prophylaxis). Post-exposure prophylaxis for lyme disease Antimicrobial prophylaxis for the prevention of lyme disease (Table 1) following tick bite may be beneficial in certain circumstances. A single dose of doxycycline can lower the risk of lyme disease when: The tick bite occurred in a state where lyme disease incidence is high (Figure 1) or in an area where >20% of ticks are infected with Borrelia burgdorferi.

Current Lyme Disease Incidence Categories by State OR CA NV ID MT WY UT AZ CO NM TX OK NE SD ND MN IA KS MO AR LA MS AL GA FL SC NC TN KY IL WI MI IN OH WV VA PA NY MA ME AK HI WA CT High Incidence DC Low Incidence DE MD NH NJ RI VT Figure 2. Blacklegged ticks. From left to right: larva, nymph, adult male, and adult female. Figure 3 ...

Tags:

  Lyme

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of Guidance for Clinicians

1 Guidance for Clinicians Caring for Patients after a Tick BiteWhen a patient seeks care after a tick bite, topics to discuss should include: Tick removalLyme disease prophylaxisSymptom watch How to Remove a TickUse fine-tipped tweezers to grasp the tick as close to the skin s surface as upward with steady, even pressure. Don t twist or jerk the removing the tick, thoroughly clean the bite area and your hands with rubbing alcohol or soap and a live tick by putting it in rubbing alcohol or placing it in a sealed bag/container. Save the tick for species identification and degree of tick engorgement (important when determining eligibility for lyme disease prophylaxis). Post-exposure prophylaxis for lyme disease Antimicrobial prophylaxis for the prevention of lyme disease (Table 1) following tick bite may be beneficial in certain circumstances. A single dose of doxycycline can lower the risk of lyme disease when: The tick bite occurred in a state where lyme disease incidence is high (Figure 1) or in an area where >20% of ticks are infected with Borrelia burgdorferi.

2 Contact your local health department for information about tick infection rates in your area. The attached tick can be identified as an adult or nymphal blacklegged tick (Figure 2). The estimated time of attachment is 36 hours based on the degree of tick engorgement with blood or likely time of exposure to the tick (Figure 3). Prophylaxis can be started within 72 hours of tick removal. The patient has no contraindication to 1. lyme disease post-exposure prophylaxis CategoryDrugDosageMaximumDurationAdultsD oxycycline200 mg orallyN/AOnceChildren weighing less than 45 mg/kg orally200 mgOnceReferencesNadelman RB, et al. Prophylaxis with single-dose doxycycline for the prevention of lyme disease after an Ixodes scapularis tick bite. N Engl J Med. 2001 Jul 12;345(2) MG, et al. A single dose of doxycycline after an Ixodes ricinus tick bite to prevent lyme borreliosis: An open-label randomized controlled trial. J Infect. 2021 Jan;82(1) : Antibiotic prophylaxis has not been shown to prevent tickborne disease other than lyme disease and is not recommended for prevention of anaplasmosis, babesiosis, ehrlichiosis, or Rocky Mountain spotted # 304282-BDecember 14, 2021123 Current lyme Disease Incidence Categories by StateORCANVIDMTWYUTAZCONMTXOKNESDNDMNIAM OKSARLAMSALGAFLSCNCTNKYILWIMIINOHWVVAPAN YMAMEAKHIWACTHigh IncidenceLow IncidenceDCDEMDNHNJRIVTF igure 2.

3 Blacklegged ticks. From left to right: larva, nymph, adult male, and adult 3. Blacklegged nymphal ticks at various stages of engorgement. Symptom watchEncourage patients to watch for fever, rash, or flu-like illness in the weeks after a tick bite. Location of tick exposure can guide the differential a person is suspected of acute tickborne disease, including early lyme disease or Rocky Mountain spotted fever, initiate treatment as soon as possible, rather than waiting for laboratory results, which may be insensitive in early


Related search queries