Transcription of Proteinase K
{{id}} {{{paragraph}}}
Example: air traffic controller
Proteinase K
Proteinase KFT-85870nProduct dataProteinase K, from Tritirachium album timber (Engyodontium album)Syn.: peptidase K, Tritirachium alkaline proteinaseProtein K powder #858706 Proteinase K solution #718961 CAS: [ 39450-01-6 ] MW: 8,900 daltons ( kDa). primary sequence for Proteinase K: GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVID TGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGS RTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKN NRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAA GNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVL DIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMT LGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA FAQ & Technical tipsWhat is Proteinase K?PProteinase K (also protease K or endopeptidase K) is a broad-spectrum serine protease widely used in molecular biology. Proteinase K is able to digest native keratin (hair), hence, the name Proteinase K . It is commonly used because of its broad specificity, that makes it useful to clean nucleic acid complexe samples and to lyse cells. It has been used for isolation of mRNA, high molecular weight DNA and to inactivate other enzymatic enzyme was discovered in 1974 in extracts of the fungus Engyodontium album (formerly Tritirachium album).
2.Isolation of plasmid and genomic DNA Genomic or plasmid DNA can be isolated from liquid nitrogen frozen cells or cultured cells using Proteinase K. Incubate 50-100 mg of tissue or 1×108 cells in 1mL of buffer containing 0.5% SDS (w/v) with Proteinase K at a concentration of 1mg/mL, for 12-18 hours at 50°C.
Tags:
Information
Domain:
Source:
Link to this page:
Please notify us if you found a problem with this document: