Example: tourism industry

+/-200V Common-Mode Voltage Difference Amplifier

INA148 1999 Burr-Brown CorporationPDS-1579 APrinted in , 1999 FEATURESlHIGH Common-Mode Voltage : +75V at VS = +5V 200V at VS = 15 VlFIXED DIFFERENTIAL GAIN = 1V/VlLOW QUIESCENT CURRENT: 260 AlWIDE SUPPLY RANGE:Single Supply: to 36 VDual Supplies: to 18 VlLOW GAIN ERROR: maxlLOW NONLINEARITY: maxlHIGH CMR: 86dBlSO-8 PACKAGE 200V Common-Mode VoltageDIFFERENCE AMPLIFIERDESCRIPTIONThe INA148 is a precision, low-power, unity-gaindifference Amplifier with a high Common-Mode inputvoltage range. It consists of a monolithic precisionbipolar op amp with a thin-film resistor on-chip resistors are laser trimmed for an accu-rate 1V/V differential gain and high common -moderejection. Excellent temperature tracking of the resis-tor network maintains high gain accuracy and com-mon-mode rejection over temperature. The INA148will operate on single or dual INA148 is available in a small SO-8 surface-mount package and it is specified for the 40 C to+85 C extended industrial temperature SHUNT MEASUREMENTSlDIFFERENTIAL SENSOR AMPLIFIERSlLINE RECEIVERSlBATTERY POWERED SYSTEMSlAUTOMOTIVE INSTRUMENTATIONlSTACKED CELL MONITORSI nternational Airport Industrial Park Mailing Address: PO Box 11400, Tucson, AZ 85734 Street Address: 6730 S.

®INA148 ©1999 Burr-Brown Corporation PDS-1579A Printed in U.S.A.December, 1999 FEATURES HIGH COMMON-MODE VOLTAGE: +75V at V S = +5V ±200V at V S = ±15V FIXED DIFFERENTIAL GAIN = 1V/V

Tags:

  Dome, Common, Voltage, Common mode voltage

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of +/-200V Common-Mode Voltage Difference Amplifier

1 INA148 1999 Burr-Brown CorporationPDS-1579 APrinted in , 1999 FEATURESlHIGH Common-Mode Voltage : +75V at VS = +5V 200V at VS = 15 VlFIXED DIFFERENTIAL GAIN = 1V/VlLOW QUIESCENT CURRENT: 260 AlWIDE SUPPLY RANGE:Single Supply: to 36 VDual Supplies: to 18 VlLOW GAIN ERROR: maxlLOW NONLINEARITY: maxlHIGH CMR: 86dBlSO-8 PACKAGE 200V Common-Mode VoltageDIFFERENCE AMPLIFIERDESCRIPTIONThe INA148 is a precision, low-power, unity-gaindifference Amplifier with a high Common-Mode inputvoltage range. It consists of a monolithic precisionbipolar op amp with a thin-film resistor on-chip resistors are laser trimmed for an accu-rate 1V/V differential gain and high common -moderejection. Excellent temperature tracking of the resis-tor network maintains high gain accuracy and com-mon-mode rejection over temperature. The INA148will operate on single or dual INA148 is available in a small SO-8 surface-mount package and it is specified for the 40 C to+85 C extended industrial temperature SHUNT MEASUREMENTSlDIFFERENTIAL SENSOR AMPLIFIERSlLINE RECEIVERSlBATTERY POWERED SYSTEMSlAUTOMOTIVE INSTRUMENTATIONlSTACKED CELL MONITORSI nternational Airport Industrial Park Mailing Address: PO Box 11400, Tucson, AZ 85734 Street Address: 6730 S.

2 Tucson Blvd., Tucson, AZ 85706 Tel: (520) 746-1111 Twx: 910-952-1111 Internet: Cable: BBRCORP Telex: 066-6491 FAX: (520) 889-1510 Immediate Product Info: (800) 548-6132 For most current data sheet and other productinformation, visit 50k 50k 1M V+VIN732641A1 INA148V RefVO+VIN SBOS1232 INA148 SPECIFICATIONS: VS = 5V to 15V Dual SuppliesAt TA = +25 C, RL = 10k connected to ground and Ref pin connected to ground, unless otherwise Voltage (VO)RTI(1)(2)Input Offset VoltageVOSVS = 15V, VCM = 0V 1 5mVVS = 5V, VCM = 0V 1 5mVDrift VOS/ TAt TA = 40 C to +85 C 10 V Cvs Power SupplyPSRRVS = to 18V, VCM = 0V 50 400 V/VINPUT Voltage RANGEC ommon-Mode Voltage RangeVCMVS = 15V, (VIN+) (VIN ) = 0V 200+200 VVS = 5V, (VIN+) (VIN ) = 0V 100+80 VCommon-Mode RejectionCMRRVS = 15V, VCM = 200V to +200V, RS = 0 7086dBVS = 5V, VCM = 100V to +80V, RS = 0 7086dBINPUT IMPEDANCED ifferential2M common Mode1M NOISERTI(1)(3) Voltage Noise, f = to 10 Hzen17 Vp-pVoltage Noise Density, f = 1kHz880nV/ HzGAINI nitial(1)1V/VGain ErrorVO = (V ) + to (V+) Temperature 3 10ppm/ CNonlinearityVS = 15V, VO = (V ) + to (V+) of FSRVS = 5V, VO = (V ) + to (V+)

3 Of FSRFREQUENCY RESPONSES mall Signal Bandwidth100kHzSlew Rate1V/ sSettling Time: = 15V, 10V Step21 = 15V, 10V Step25 = 5V, 6V Step21 = 5V, 6V Step25 sOverload Recovery50% Input Overload24 sOUTPUT (VO) Voltage OutputRL = 100k (V ) + (V+) 1 VRL = 10k (V ) + (V+) CurrentIOShort-Circiuit CurrentContinuous to common 13mACapacitive LoadStable Operation10nFPOWER SUPPLYO perating Range, Dual Supplies 18 VQuiescent CurrentVIN = 0, IO = 0 260 300 ATEMPERATURE RANGES pecified 4085 COperating 55125 CStorage 55125 CThermal Resistance JASO-8 Surface Mount150 C/WNOTES: (1) Overall Difference Amplifier configuration. Referred to input pins (VIN+ and VIN ), gain = 1V/V (2) Input offset Voltage specification includes effects ofamplifier's input bias and offset currents. (3) Includes effects of input current noise and thermal noise contribution of resistor INA148 SPECIFICATIONS: VS = +5V Single SupplyAt TA = +25 C, RL = 10k connected to VS/2 and Ref pin connected to VS/2, unless otherwise Voltage (VO)RTI(1)(2)Input Offset VoltageVOSVCM = VS/2 1 5mVDrift VOS/ TAt TA = 40 C to +85 C 10 V Cvs Power SupplyPSRRVS = + to +36V, VCM = VS/2 50 400 V/VINPUT Voltage RANGEC ommon-Mode Voltage RangeVCM(VIN+) (VIN ) = 0V, VREF = 4+75V(VIN+) (VIN ) = 0V, VREF = VS/2 + RejectionCMRRVCM = to + , RS = 0 7086dBINPUT IMPEDANCED ifferential2M common Mode1M NOISERTI(1)(3) Voltage Noise, f = to 10 Hzen17 Vp-pVoltage Noise Density, f = 1kHz880nV/ HzGAINI nitial(1)1V/VGain ErrorVO = + to + Temperature 3 10ppm/ CNonlinearityVO = + to + of FSRFREQUENCY RESPONSES mall Signal Bandwidth100kHzSlew Rate1V/ sSettling Time.

4 = +5V, 3V Step21 = +5V, 3V Step25 sOverload Recovery50% Input Overload13 sOUTPUT (VO) Voltage OutputRL = 100k (V ) + (V+) 1 VRL = 10k (V ) + (V+) CurrentIOShort-Circiuit CurrentContinuous to common 8mACapacitive LoadStable Operation10nFPOWER SUPPLYO perating Range, Single Supply+ +36 VQuiescent CurrentVIN = 0, IO = 0260300 ATEMPERATURE RANGES pecified 4085 COperating 55125 CStorage 55125 CThermal Resistance JASO-8 Surface Mount150 C/WNOTES: (1) Overall Difference Amplifier configuration. Referred to input pins (VIN+ and VIN ), gain = 1V/V (2) Input offset Voltage specification includes effects ofamplifier's input bias and offset currents. (3) Includes effects of input current noise and thermal noise contribution of resistor INA148 ELECTROSTATICDISCHARGE SENSITIVITYThis integrated circuit can be damaged by ESD. Burr-Brownrecommends that all integrated circuits be handled withappropriate precautions.

5 Failure to observe proper handlingand installation procedures can cause damage can range from subtle performance degradationto complete device failure. Precision integrated circuits maybe more susceptible to damage because very small parametricchanges could cause the device not to meet its information provided herein is believed to be reliable; however, BURR-BROWN assumes no responsibility for inaccuracies or omissions. BURR-BROWN assumesno responsibility for the use of this information, and all use of such information shall be entirely at the user s own risk. Prices and specifications are subject to changewithout notice. No patent rights or licenses to any of the circuits described herein are implied or granted to any third party. BURR-BROWN does not authorize or warrantany BURR-BROWN product for use in life support devices and/or Voltage , V+ to V .. 36 VSignal Input Terminals, Continuous.

6 200 VPeak ( ) .. 500 VOutput Short Circuit to GND Duration .. ContinuousOperating Temperature .. 55 C to +125 CStorage Temperature .. 55 C to +125 CJunction Temperature .. +150 CLead Temperature (soldering, 10s) .. +300 CNOTE: (1) Stresses above these ratings may cause permanent to absolute maximum conditions for extended periods may degradedevice reliability. These are stress ratings only, and functional operation of thedevice at these or any other conditions beyond those specified is not MAXIMUM RATINGS(1)PACKAGESPECIFIEDDRAWINGTEMPERA TUREPACKAGEORDERINGTRANSPORTPRODUCTPACKA GENUMBERRANGEMARKINGNUMBER(1)MEDIAINA148 UASO-8182 40 C to +85 CINA148 UAINA148 UARails"""""INA148UA/2K5 Tape and ReelNOTE: (1) Models with a slash (/) are available only in Tape and Reel in the quantities indicated ( , /2K5 indicates 2500 devices per reel). Ordering 2500 piecesof INA148UA/2K5 will get a single 2500-piece Tape and INFORMATIONPIN CONFIGURATIONTOP VIEWSO-8 Ref In+InV NCV+OutNC123487655 INA148 TYPICAL PERFORMANCE CURVESAt TA = +25 C, VS = 15V, RL = 10k to common , and VREF = 0V, unless otherwise 5 10 20 25 30 35101001k10k100k1 MVoltage Gain (dB)Frequency (Hz)GAIN vs FREQUENCYVS= = 15V100806040200101001k10k100k1 MVoltage Gain (dB)Frequency (Hz) Common-Mode REJECTION vs FREQUENCY= VS = 15V= VS = Supply Rejection (dB)Frequency (Hz)POWER SUPPLY REJECTION vs FREQUENCYPSR+(VS = 18V)PSR+(VS = )PSR (VS = 18V)PSR (VS = )8001k600400200100101001k10k100kINPUT Voltage NOISE SPECTRAL DENSITYI nput Noise Spectral Density (nV/ Hz)Frequency (Hz)290280270260250240230220210 60 40 20020406080100120140 Temperature ( C)IQ ( A)QUIESCENT CURRENT vs TEMPERATUREVS = = 15V1s/div5 V/divVOLTAGE NOISE (RTI)

7 To 10Hz6 INA148 TYPICAL PERFORMANCE CURVES (Cont.)At TA = +25 C, VS = 15V, RL = 10k to common , and VREF = 0V, unless otherwise 5 10 15 20 60 40 20020406080100120140+SC SCSHORT-CIRCUIT CURRENT vs TEMPERATURET emperature ( C)Short-Circuit Current (mA)5V/div25 s/div+125 C+125 C 55 C 55 CLARGE-SIGNAL STEP RESPONSE vs TEMPERATURE25 s/div5V/divLARGE-SIGNAL STEP RESPONSE(RL = 10k , CL = 10pF)10 s/div50mV/divSMALL-SIGNAL STEP RESPONSE(RL = 10k , CL = 10pF)5V/div100 s/divLARGE-SIGNAL CAPACITIVE LOAD RESPONSE(CL = 1nF and 10nF)VIN CL = 1nFCL = 10nFG = +1V/V5V/div1ms/divRL = 1k RL = 10k RL = 100k RL = 1k RL = 10k RL = 100k OUTPUT Voltage SWING vs RL7 INA148 TYPICAL PERFORMANCE CURVES (Cont.)At TA = +25 C, VS = 15V, RL = 10k to common , and VREF = 0V, unless otherwise Voltage , RTI (mV)Percent of Amplifiers (%)OFFSET Voltage PRODUCTION DISTRIBUTIONVS = 15V24201612840 Voltage , RTI (mV)Percent of Amplifiers (%)OFFSET Voltage PRODUCTION DISTRIBUTIONVS = Voltage Drift, RTI ( V/ C)Percent of Amplifiers (%)OFFSET Voltage DRIFT PRODUCTION DISTRIBUTIONVS = 15V Voltage Drift, RTI ( V/ C)Percent of Amplifiers (%)OFFSET Voltage DRIFT PRODUCTION DISTRIBUTIONVS = Drift (ppm/ C)Percent of Amplifiers (%)GAIN DRIFT PRODUCTION DISTRIBUTIONVS = 15V403020100 Drift (ppm/ C)Percent of Amplifiers (%)GAIN DRIFT PRODUCTION DISTRIBUTIONVS = INA148 FIGURE 1.

8 Basic Circuit PERFORMANCE CURVES (Cont.)At TA = +25 C, VS = 15V, RL = 10k to common , and VREF = 0V, unless otherwise INFORMATIONThe INA148 is a unity gain Difference Amplifier with a highcommon-mode input Voltage range. A basic diagram of thecircuit and pin connections is shown in Figure achieve its high Common-Mode Voltage range, the INA148features a precision laser-trimmed thin-film resistor networkwith a 20:1 input Voltage divider ratio. High input voltagesare thereby reduced in amplitude, allowing the internal opamp to see input voltages that are within its linear oper-ating range. A Tee network in the op amp feedbacknetwork places the Amplifier in a gain of 20V/V, thusrestoring the circuit s overall gain to unity (1V/V).External voltages can be summed into the Amplifier s outputby using the Ref pin, making the differential Amplifier ahighly versatile design tool.

9 Voltages on the Ref pin willalso influence the INA148 s Common-Mode Voltage accordance with good engineering practice for linearintegrated circuits, the INA148 s power-supply bypasscapacitors should be connected as close to pins 4 and 7 aspracticable. Ceramic or tantalum types are recommended foruse as bypass input impedances are unusually high for a differenceamplifier and this should be considered when routing inputsignal traces on a PC board. Avoid placing digital signaltraces near the Difference Amplifier s input traces to mini-mize noise VOLTAGEThe INA148 is specified for 15V and 5V dual suppliesand +5V single supplies. The INA148 can be operated withsingle or dual supplies with excellent INA148 is fully characterized for supply voltages from to 18V and over temperatures of 55 C to +125 that vary significantly with operating Voltage ,load conditions, or temperature are shown in the TypicalPerformance Curves s/div5V/divINVERTING INPUT50% OVERLOAD RECOVERY TIME1M 50k 50k 1M VIN732641A1 INA148 VSVO+VIN F+ FVO = (VIN VIN) +5 s/div5V/divNON-INVERTING INPUT50% OVERLOAD RECOVERY TIMEVS = 15 VVIN VOUT0V0 VVIN+VOUT0 VVS = 15V9 INA148 FIGURE 2.

10 Optional Offset Trim 3. Preferred Offset Trim GAIN EQUATIONAn internal on-chip resistor network sets the overall differ-ential gain of the INA148 to precisely 1V/V. It s output isaccordance with the equation:VOUT = (VIN+ VIN ) + VREF(1) Common-Mode RANGEThe 20:1 input resistor ratio of the INA148 provides an inputcommon-mode range that extends well beyond its powersupply exact input Voltage range depends on the Amplifier spower-supply Voltage and the Voltage applied to the Refterminal (pin 1). Typical input Voltage ranges at differentpower supply voltages can be found in the applicationscircuits TRIMThe INA148 is laser-trimmed for low offset Voltage anddrift. Most applications will require no external offset a Voltage applied to the reference (Ref) pin (pin 1) willbe summed directly into the Amplifier s output signal, thistechnique can be used to null the Amplifier s input offsetvoltage.


Related search queries