Transcription of High Common-Mode Voltage DIFFERENCE …
1 INA117 FEATURES Common-Mode INPUT RANGE: 200V (VS = 15V) PROTECTED INPUTS: 500V Common-Mode 500V Differential UNITY GAIN: Gain Error max NONLINEARITY: max CMRR: 86dB minAPPLICATIONS CURRENT MONITOR BATTERY CELL- Voltage MONITOR GROUND BREAKER INPUT PROTECTION SIGNAL ACQUISITION IN NOISYENVIRONMENTS FACTORY AUTOMATIONDESCRIPTIONThe INA117 is a precision unity-gain differenceamplifier with very high Common-Mode input voltagerange. It is a single monolithic IC consisting of aprecision op amp and integrated thin-film resistornetwork. It can accurately measure small differentialvoltages in the presence of Common-Mode signals upto 200V. The INA117 inputs are protected frommomentary Common-Mode or differential overloadsup to many applications, where galvanic isolation is notessential, the INA117 can replace isolation can eliminate costly isolated input-side powersupplies and their associated ripple, noise and quies-cent current.
2 The INA117 s nonlinearity and200kHz bandwidth are superior to those of conven-tional isolation INA117 is available in 8-pin plastic mini-DIP andSO-8 surface-mount packages, specified for the 40 Cto +85 C temperature range. The metal TO-99 modelsare available specified for the 40 C to +85 C and 55 C to +125 C temperature Common-Mode VoltageDIFFERENCE AMPLIFIERRefB In+InV CompV+ 380k 380k 380k 20k 2000, Texas Instruments IncorporatedSBOS154 APrinted in December, 2000 INA117 SBOS154A2 SPECIFICATIONSAt TA = +25 C, VS = 15V, unless otherwise , SMINA117 BMINA117P, KUPARAMETERCONDITIONSMINTYPMAXMINTYPMAXM INTYPMAXUNITSGAINI nitial (1)1 %vs Temperature210 ppm/ CNonlinearity (2) %OUTPUTR ated VoltageIO = +20mA, 5mA1012 VRated CurrentVO = 10V+20, 5 Current LimitTo common +49, 13 mACapacitive LoadStable Operation1000 pFINPUTI mpedanceDifferential800 k common -Mode400 k Voltage RangeDifferential 10 VCommon-Mode, Continuous 200 VCommon-Mode Rejection (3)
3 DC70808694 dBAC, 60 HzVCM = 400Vp-p66806694 dBvs Temperature, DCTA = TMIN to TMAXAM, BM, P, KU66758090 dBSM6075dBOFFSET VOLTAGERTO (4)Initial1201000 1000 VKU Grade (SO-8 Package)6002000 Vvs TemperatureTA = TMIN to 40 V/ Cvs SupplyVS = 5V to 18V749080 dBvs Time200 V/moOUTPUT NOISE VOLTAGERTO (5)fB = to 10Hz25 Vp-pfB = 10kHz550 nV/ HzDYNAMIC RESPONSEGain Bandwidth, 3dB200 kHzFull Power BandwidthVO = 20Vp-p30 kHzSlew V/ sSettling Time: = 10V = 10V Step10 = 10V Step, VDIFF = sPOWER SUPPLYR ated 15 VVoltage RangeDerated Performance 5 18 VQuiescent CurrentVO = mATEMPERATURE RANGES pecification: AM, BM, P, KU 25+85 40+85 CSM 55+125 COperation 55+125 40+85 CStorage 65+150 55+125 C Specification same as for : (1) Connected as DIFFERENCE amplifier (see Figure 1). (2) Nonlinearity is the maximum peak deviation from the best-fit straight line as a percent of full-scalepeak-to-peak output.
4 (3) With zero source impedance (see discussion of Common-Mode rejection in Application Information section). (4) Includes effects of amplifier sinput bias and offset currents. (5) Includes effects of amplifier s input current noise and thermal noise contribution of resistor In+InV CompV+OutputRefA1234876587621345 TabCompOutputV+V Ref ARef B In+InCase internally connected to V . Make no CONFIGURATIONTop ViewTO-99 INA117AM, BM, SMTop ViewDIP/SOINA117P, KUPACKAGESPECIFIEDDRAWINGTEMPERATUREPACK AGEORDERINGTRANSPORTPRODUCTPACKAGENUMBER RANGEMARKINGNUMBER(1)MEDIAINA117 PDIP-8006 40 C to +85 CINA117 PINA117 PRailsINA117 KUSO-8 Surface-Mount182"INA117 KUINA117 KURails"""""INA117KU/2K5 Tape and ReelINA117 AMTO-99 Metal001 25 C to +85 CINA117 AMINA117 AMRailsINA117BM"""INA117 BMINA117 BMRailsINA117SM"" 55 C to +125 CINA117 SMINA117 SMRailsNOTE: (1) Models with a slash (/) are available only in Tape and Reel in the quantities indicated ( , /2K5 indicates 2500 devices per reel).
5 Ordering 2500pieces of INA117KU/2K5 will get a single 2500-piece Tape and INFORMATIONELECTROSTATICDISCHARGE SENSITIVITYThis integrated circuit can be damaged by ESD. Texas Instru-ments recommends that all integrated circuits be handled withappropriate precautions. Failure to observe proper handlingand installation procedures can cause damage can range from subtle performance degrada-tion to complete device failure. Precision integrated circuitsmay be more susceptible to damage because very smallparametric changes could cause the device not to meet itspublished MAXIMUM RATINGSS upply Voltage .. 22 VInput Voltage Range, Continuous .. 200 VCommon-Mode and Differential, 10s .. 500 VOperating TemperatureM Metal TO-99 .. 55 to +125 CP Plastic DIP and U SO-8 .. 40 to +85 CStorage TemperatureM Package .. 65 to +150 CP Plastic DIP and U SO-8.
6 55 to +125 CLead Temperature (soldering, 10s) .. +300 COutput Short Circuit to common .. ContinuousINA117 SBOS154A4 TYPICAL PERFORMANCE CURVESAt TA = +25 C, VS = 15V, unless otherwise Common-Mode Voltage RANGEvs POSITIVE POWER-SUPPLY VOLTAGEP ositive Power-Supply Voltage (V)510152040035030025020015010050 Positive Common-Mode Range (V)TA = +25 C TA = 55 CTA = +125 C VS = 5V to 20 VMax Rating = 200 VNEGATIVE Common-Mode Voltage RANGEvs NEGATIVE POWER-SUPPLY VOLTAGEN egative Power-Supply Voltage (V) 5 10 15 20 400 350 300 250 200 150 100 50 Negative Common-Mode Range (V)TA = +25 CTA = 55 C to +125 C+VS = +5V to +20 VMax Rating = 200 VPOWER-SUPPLY REJECTION vs FREQUENCYF requency (Hz)1101001k10k100908070605040 Power-Supply Rejection (dB)V+V Common-Mode REJECTION vs FREQUENCYF requency (Hz)201001k10k100k2M100908070605040 Common-Mode Rejection (dB)INA117AM, SM, P, KUINA117 BMINA117 SBOS154A5 TYPICAL PERFORMANCE CURVES (Cont.)
7 At TA = +25 C, VS = 15V, unless otherwise SIGNAL STEP RESPONSECL = 1000pFSMALL SIGNAL STEP RESPONSECL = 0 LARGE SIGNAL STEP RESPONSEINA117 SBOS154A6 APPLICATION INFORMATIONF igure 1 shows the basic connections required for with noisy or high -impedance power-supply linesmay require decoupling capacitors close to the device output Voltage is equal to the differential input volt-age between pins 2 and 3. The common mode inputvoltage is circuitry connected to the compensation pin 8 can-cels the parasitic distributed capacitance between the feed-back resistor, R2, and the IC substrate. For specified dy-namic performance, pin 8 should be grounded or connectedthrough a F capacitor to an AC ground such as V+. Common-Mode REJECTIONC ommon-mode rejection (CMR) of the INA117 is depend-ent on the input resistor network, which is laser-trimmed foraccurate ratio matching.
8 To maintain high CMR, it is impor-tant to have low source impedances driving the two 75 resistance in series with pin 2 or 3 will decrease CMRfrom 86dB to in series with the reference pins will also degradeCMR. A 4 resistance in series with pin 1 or 5 will decreaseCMRR from 86dB to applications do not require trimming. Figures 2 and 3show optional circuits that may be used for trimming offsetvoltage and Common-Mode FUNCTIONMost applications use the INA117 as a simple unity-gaindifference amplifier. The transfer function is:VO = V3 V2V3 and V2 are the voltages at pins 3 and 1. Basic Power and Signal Connections.++380k 380k 380k 20k 4723815 15V+15V1 FTantalum1 FTantalum In = V2+In = V3VO = V3 V26R1R2R4R5R3380k 380k 380k 20k 4723815V V+V2V3VO = V3 V26100k 10 50k 15V+15V380k 380k 380k 20k 4723815V V+V2V3V = V VO 3 2610k 10mV100 100 V+V 100 A1/2 REF200100 A1/2 REF200 OPA27 Offset adjustment is regulated insensitive to power supply variations.
9 (a)(b)FIGURE 2. Offset Voltage Trim applications, however, apply voltages to the referenceterminals (pins 1 and 5). A more complete transfer functionis:VO = V3 V2 + 19 V5 18 V1V5 and V1 are the voltages at pins 5 and CURRENTThe INA117 can be used to measure a current by sensing thevoltage drop across a series resistor, RS. Figure 4 shows theINA117 used to measure the supply currents of a deviceunder test. The circuit in Figure 5 measures the outputcurrent of a power supply. If the power supply has a senseconnection, it can be connected to the output side of RS toeliminate the Voltage -drop error. Another common applica-tion is current-to- Voltage conversion, as shown in Figure 4. Measuring Supply Currents of Device 380k 380k 20k 4723815V V+V2V3VO = V3 V26200 10 10 If offset adjust is also required,connect to offset circuit, Figure 3.
10 CMR Trim 5. Measuring Power Supply Output 20k 380k 380k 380k 380k 380k 47238156 RSRC*CIDUT+IDUT 20k 4723815V V+6 RSV V+DeviceUnderTest VS+VS*Not needed if R is less than 20 see text. S(+200V max)( 200V max)VO = RS IDUT+VO = RS IDUT RC*380k 380k 380k 20k 47238156 RSRC*ILV V+ 200V maxLoadPower SupplyOutSense*RC = RS not needed if RS is less than 20 see LoadSense Connection(see text)VO = IL RSINA117 SBOS154A8 FIGURE 6. Current to Voltage 380k 380k 20k 23815VO = 1V to 5V6 VSRS( 200V max)4 to 20mA*Not needed if RS is less than 20 see RC*250 380k 380k 380k 20k 23815VO = 1V to 5V6VS( 200V max)4 to 20mA*Not needed if RS is less than 20 see RC*250 380k 380k 380k 20k 238156RC*VO = 1V to 5 VVS*Not needed if RS is less than 20 see 4 to 20mA( 200V max)RS250 380k 380k 380k 20k 23815VO = 1V to 5V6VS( 200V max)4 to 20mA*Not needed if RS is less than 20 see RC*250 (a)(c)(b)(d)INA117 SBOS154A9In all cases, the sense resistor imbalances the input resistormatching of the INA117, degrading its CMR.
