Example: bachelor of science

technical guide Air-Cooled Self-Contained Units - UPGNET

technical guideAir-CooledSelf- contained Units2 johnson ControlsTechnical guide : (810) Air-Cooled Self-Contained UnitsIntroduction.. 2 Product Overview .. 3 Nomenclature .. 4 Horizontal DSH Units .. 5 Horizontal Application & Installation .. 5 DSH Physical Data .. 6 DSH Performance Data .. 7 DSH Fan Performance Data.. 8 DSH Electrical Data .. 9 DSH Dimensional Data.. 10 DSH Airside Economizer .. 13 Vertical DSV Units .. 15 Vertical Application & Installation .. 15 DSV Physical Data .. 16 DSV Performance Data .. 17 DSV Fan Performance Data.. 19 DSV Electrical Data .. 20 DSV Dimensional Data .. 21 DSV Discharge Plenum .. 26 DSV Airside Economizer.. 27 Wiring Diagrams .. 29 Specifications .. 32 TABLE OF CONTENTSI ndoor packaged solutions for convenient floor-by-floor D-Series Self-Contained Horizontal and Vertical Indoor Air-Conditioning packages from YORK offer a complete line of unit options for high-rise and single-story building s compact, low profile indoor design protects against potential vandalism and weathering and eliminates the need for any unsightly exterior equipment.

4 Johnson Controls Technical Guide: YK145.00-EG2 (810) Air-Cooled Self-Contained Units NOMENCLATURE Air-Cooled Self-Contained Unit Product Category DS = Air-Cooled Pkg.

Tags:

  Guide, Control, Technical, Unit, Self, Cooled, Johnson, Contained, Air cooled self contained units, Johnson controls technical guide, Technical guide air cooled self contained units

Information

Domain:

Source:

Link to this page:

Please notify us if you found a problem with this document:

Other abuse

Advertisement

Transcription of technical guide Air-Cooled Self-Contained Units - UPGNET

1 technical guideAir-CooledSelf- contained Units2 johnson ControlsTechnical guide : (810) Air-Cooled Self-Contained UnitsIntroduction.. 2 Product Overview .. 3 Nomenclature .. 4 Horizontal DSH Units .. 5 Horizontal Application & Installation .. 5 DSH Physical Data .. 6 DSH Performance Data .. 7 DSH Fan Performance Data.. 8 DSH Electrical Data .. 9 DSH Dimensional Data.. 10 DSH Airside Economizer .. 13 Vertical DSV Units .. 15 Vertical Application & Installation .. 15 DSV Physical Data .. 16 DSV Performance Data .. 17 DSV Fan Performance Data.. 19 DSV Electrical Data .. 20 DSV Dimensional Data .. 21 DSV Discharge Plenum .. 26 DSV Airside Economizer.. 27 Wiring Diagrams .. 29 Specifications .. 32 TABLE OF CONTENTSI ndoor packaged solutions for convenient floor-by-floor D-Series Self-Contained Horizontal and Vertical Indoor Air-Conditioning packages from YORK offer a complete line of unit options for high-rise and single-story building s compact, low profile indoor design protects against potential vandalism and weathering and eliminates the need for any unsightly exterior equipment.

2 The compact dimensions allow for easy installation through doorways, hallways and installation provides independent zone and temperature control , eliminating many of the complica-tions encountered with rooftop equipment. Renovation and restoration projects are simplified where roof load, cooling tower, and construction restrictions can present installation D-Series Air-Cooled Self-Contained design by YORK features high efficiency, quality engineering and depend-able / CertificationsINTRODUCTIONJ ohnson Controls 3 Air-Cooled Self-Contained Units technical guide : (810)PRODUCT OVERVIEWR efrigerantR-410 ASizes2 20 Tons ( kW)ModelsDSH (Horizontal) 2-10 TonsDSV (Vertical) 3-20 TonsFeatures Ideal for the renovation/retrofit of interior spaces, in both high-rise and low-rise buildings Preserves aesthetics of building exterior; the necessity for unsightly exterior equipment is eliminated Equipment is protected from extreme weather conditions and vandalism Floor-by-floor, or zone-by-zone, installation allows independent metering / temperature control Convenient indoor access for all service needs unit casings are constructed of heavy gauge galvanized steel.

3 Cabinet interiors are lined with 1/2 inch thick, 2 lb. density, acoustic insulation Separate evaporator and condensing unit modules, allowing field separation if required for ease of ingress / handling in building corridors or elevators. Belt driven centrifugal blowers, with adjustable pulleys, are employed for both evaporator and condenser air movement; field adjustment of external static pressure capability to suit a wide range of installation requirements High efficiency Scroll compressors Each refrigerant circuit complete with schraeder access fittings, sight glass/moisture indicator, filter drier, and thermal expansion valve with external equalizer Refrigerant circuit isolation valves, with service ports, allow installation of Units as a split evaporator / condensing unit system (DSH models only) Dual independent compressor circuits on 8, 10, 12, 15, and 20 ton models Electronic compressor protection / diagnostic module; includes phase protection on 3-phase units4 johnson ControlsTechnical guide : (810) Air-Cooled Self-Contained UnitsNOMENCLATUREAir- cooled Self-Contained UnitProduct CategoryDS = Air-Cooled Pkg.

4 A/C R-410 AProduct IndentifierV = Vertical ArrangementH = Horizontal Arrangment Miscellaneous OptionsA = NoneD = Condensate Overflow Switch Heating Options0 = NoneDesign SeriestnerruC = ARefrigerant Circuit OptionsA = NoneB = Hot Gas BypassNominal Capacity036 = 3 TON024 = 2 TON 4 TON = 840060 = 5 TON096 = 8 TON120 = 10 TON144 = 12 TON180 = 15 TONNOT 02 = 042 Voltage1-06-032/802 = 13-06-032/802 = 24 = 460-60-35 = 575-60-3 Outdoor Airside OptionsA = Std Airside coilC = Corrosion Protective CoatingControl OptionsE = Std Electromechnical ControlsIndoor Airside OptionsA = Std Airside coilC = Corrosion Protective CoatingD = Stainless Steel Drain PanF = Coated Coil w/ S-S Drain PanIndoor Motor1 = Std2 = High StaticDS V 180 A 2 E 1 A A A 0 A1,2 3 4,5,6 7 8 9 10 11 12 13 14 15 johnson Controls 5 Air-Cooled Self-Contained Units technical guide : (810)HORIZONTAL APPLICATION & INSTALLATION6 johnson ControlsTechnical guide .

5 (810) Air-Cooled Self-Contained UnitsDSH PHYSICAL DATAHORIZONTAL AIR cooled DSH SERIES R-410A ModelDSH024 DSH036 DSH048 DSH060 DSH096 DSH120 Nominal Cooling (Tons)2345810 RefrigerantR-410AR-410AR-410AR-410AR-410 AR-410 ACooling PerformanceGross Cooling Capacity(Btu/h) (1)25,20036,60049,50062,00094,900119,700 Design CFM8001,2001,6002,0003,2004,000 Net Cooling Capacity24,700 (2)35,600 (2)48,500 (2)60,800 (2)92,000 (3)114,000 (3)Net Cooling CFM8001,2001,6002,0003,2003,600 SEER (2) (3)N/AN/AN/ Coil-TypeEnhanced Copper Tubes, Enhanced Aluminum FinsDimension- Height x Width (in) Area (sq ft) Quantity/Size(in)2 - 20x14x22-20x14x22-25x16x22-25x16x24-16X2 0X24-16X20X2 Condenser Coil-TypeEnhanced Copper Tubes, Enhanced Aluminum FinsDimension- Height x Width (in)20X4220X4232X3623X4531X5931x59 Face Area (sq ft) Fan-TypeCentrifugal, Forward x Width(in)1-9x71-10x81-12x91-12x91-15X151 -15x15 DriveAdjustable BeltMotor HP (Standard) 1/4 1/3 3/41 1 1/22 Condenser Fan-TypeCentrifugal, Forward x Width(in)1-10x101-10x101-12x111-12x111-1 8X131-18x13 DriveAdjustable BeltMotor HP (Standard) 1/2 3/41 1 1/22 3 DimensionsHeight (in)222225253232 Width (in)565664648080 Depth (in)78788686112112 WeightOperating (lbs)56559574086014701560 Shipping (lbs)60063089592015601620(1) Cooling performance is rated at 95 F ambient, 80 F entering dry bulb, 67 F web bulb and CFM listed.

6 Gross capacity does not include the effect of fan motor heat.(2) Rated in accordance with ANSI/AHRI Standard 210/240(3) Rated in accordance with ANSI/AHRI Standard 340/360 johnson Controls 7 Air-Cooled Self-Contained Units technical guide : (810)DSH PERFORMANCE DATAM odel CFMEDBA mbient Condenser Air Temperature85 F95 F105 F115 F62 F EWB67 F EWB72 F EWB62 F EWB67 F EWB72 F EWB62 F EWB67 F EWB72 F EWB62 F EWB67 F EWB72 F EWBTCSCTCSCTCSCTCSCTCSCTCSCTCSCTCSCTCSCT CSCTCSCTCSCDSH02470075 F80 F85 F80 F85 F80 F85

7 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85

8 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 F80 F85 johnson ControlsTechnical guide .

9 (810) Air-Cooled Self-Contained UnitsDSH FAN PERFORMANCE DATAEVAPORATOR FAN PERFORMANCEMODEL #SUPPLYCFMEXTERNAL STATIC PRESSURE - Inches BHP RPM BHP RPM BHP RPM BHP RPM BHP RPM BHP RPM BHP RPM BHPDSH024A700593 1048 1175 1169 1178 1170 1141 1046 1056 1018 1037 1029 1086 1034 1005 1019 1000 1046 1038 1076 1002 1042

10 1085 :1. At high evaporator air flows, and wet bulb conditions, condensate carry-over may occur. Adjust airflow downward as Values include pressure drop from wet coil and clean Shaded cells indicate oversized FAN PERFORMANCEMODEL #OUTDOORCFMEXTERNAL STATIC PRESSURE - Inches Controls 9 Air-Cooled Self-Contained Units technical guide : (810)DSH ELECTRICAL DATADSH ELECTRICAL DATA-STANDARD MOTOR MODEL #VOLTAGECOMPRESSOREVAPORATOR FANCONDENSER FANMIN. CCT. MAX FUSE / QTYRLALRAHPFLAHPFLAAMPACITYCCT. BKR. AMPDSH024A1208-230/1/601@ @ @ @ @ @ @ ELECTRICAL DATA-OVERSIZED MOTOR MODEL #VOLTAGECOMPRESSOREVAPORATOR FANCONDENSER FANMIN. CCT. MAX FUSE / QTYRLALRAHPFLAHPFLAAMPACITYCCT. BKR. AMPDSH096A2208-230/3/602@ @ Data shown for packaged unit installation, with single point power supply.**For split installation with separate evaporator motor power supply, calculate MCA and MFS as follows -Min.


Related search queries