Transcription of High Common-Mode Voltage DIFFERENCE …
1 INA117 FEATURES Common-Mode INPUT RANGE: 200V (VS = 15V) PROTECTED INPUTS: 500V Common-Mode 500V Differential UNITY GAIN: Gain Error max NONLINEARITY: max CMRR: 86dB minAPPLICATIONS CURRENT MONITOR BATTERY CELL- Voltage MONITOR GROUND BREAKER INPUT PROTECTION SIGNAL ACQUISITION IN NOISYENVIRONMENTS FACTORY AUTOMATIONDESCRIPTIONThe INA117 is a precision unity-gain differenceamplifier with very high Common-Mode input voltagerange. It is a single monolithic IC consisting of aprecision op amp and integrated thin-film resistornetwork. It can accurately measure small differentialvoltages in the presence of Common-Mode signals upto 200V.
2 The INA117 inputs are protected frommomentary Common-Mode or differential overloadsup to many applications, where galvanic isolation is notessential, the INA117 can replace isolation can eliminate costly isolated input-side powersupplies and their associated ripple, noise and quies-cent current. The INA117 s nonlinearity and200kHz bandwidth are superior to those of conven-tional isolation INA117 is available in 8-pin plastic mini-DIP andSO-8 surface-mount packages, specified for the 40 Cto +85 C temperature range. The metal TO-99 modelsare available specified for the 40 C to +85 C and 55 C to +125 C temperature Common-Mode VoltageDIFFERENCE AMPLIFIERRefB In+InV CompV+ 380k 380k 380k 20k 2000, Texas Instruments IncorporatedSBOS154 APrinted in December, 2000 INA117 SBOS154A2 SPECIFICATIONSAt TA = +25 C, VS = 15V, unless otherwise , SMINA117 BMINA117P, KUPARAMETERCONDITIONSMINTYPMAXMINTYPMAXM INTYPMAXUNITSGAINI nitial (1)1 %vs Temperature210 ppm/ CNonlinearity (2)
3 %OUTPUTR ated VoltageIO = +20mA, 5mA1012 VRated CurrentVO = 10V+20, 5 Current LimitTo common +49, 13 mACapacitive LoadStable Operation1000 pFINPUTI mpedanceDifferential800 k common -Mode400 k Voltage RangeDifferential 10 VCommon-Mode, Continuous 200 VCommon-Mode Rejection (3)DC70808694 dBAC, 60 HzVCM = 400Vp-p66806694 dBvs Temperature, DCTA = TMIN to TMAXAM, BM, P, KU66758090 dBSM6075dBOFFSET VOLTAGERTO (4)Initial1201000 1000 VKU Grade (SO-8 Package)6002000 Vvs TemperatureTA = TMIN to 40 V/ Cvs SupplyVS = 5V to 18V749080 dBvs Time200 V/moOUTPUT NOISE VOLTAGERTO (5)fB = to 10Hz25 Vp-pfB = 10kHz550 nV/ HzDYNAMIC RESPONSEGain Bandwidth, 3dB200 kHzFull Power BandwidthVO = 20Vp-p30 kHzSlew V/ sSettling Time: = 10V = 10V Step10 = 10V Step, VDIFF = sPOWER SUPPLYR ated 15 VVoltage RangeDerated Performance 5 18 VQuiescent CurrentVO = mATEMPERATURE RANGES pecification.
4 AM, BM, P, KU 25+85 40+85 CSM 55+125 COperation 55+125 40+85 CStorage 65+150 55+125 C Specification same as for : (1) Connected as DIFFERENCE amplifier (see Figure 1). (2) Nonlinearity is the maximum peak deviation from the best-fit straight line as a percent of full-scalepeak-to-peak output. (3) With zero source impedance (see discussion of Common-Mode rejection in Application Information section). (4) Includes effects of amplifier sinput bias and offset currents. (5) Includes effects of amplifier s input current noise and thermal noise contribution of resistor In+InV CompV+OutputRefA1234876587621345 TabCompOutputV+V Ref ARef B In+InCase internally connected to V.
5 Make no CONFIGURATIONTop ViewTO-99 INA117AM, BM, SMTop ViewDIP/SOINA117P, KUPACKAGESPECIFIEDDRAWINGTEMPERATUREPACK AGEORDERINGTRANSPORTPRODUCTPACKAGENUMBER RANGEMARKINGNUMBER(1)MEDIAINA117 PDIP-8006 40 C to +85 CINA117 PINA117 PRailsINA117 KUSO-8 Surface-Mount182"INA117 KUINA117 KURails"""""INA117KU/2K5 Tape and ReelINA117 AMTO-99 Metal001 25 C to +85 CINA117 AMINA117 AMRailsINA117BM"""INA117 BMINA117 BMRailsINA117SM"" 55 C to +125 CINA117 SMINA117 SMRailsNOTE: (1) Models with a slash (/) are available only in Tape and Reel in the quantities indicated ( , /2K5 indicates 2500 devices per reel).
6 Ordering 2500pieces of INA117KU/2K5 will get a single 2500-piece Tape and INFORMATIONELECTROSTATICDISCHARGE SENSITIVITYThis integrated circuit can be damaged by ESD. Texas Instru-ments recommends that all integrated circuits be handled withappropriate precautions. Failure to observe proper handlingand installation procedures can cause damage can range from subtle performance degrada-tion to complete device failure. Precision integrated circuitsmay be more susceptible to damage because very smallparametric changes could cause the device not to meet itspublished MAXIMUM RATINGSS upply Voltage .
7 22 VInput Voltage Range, Continuous .. 200 VCommon-Mode and Differential, 10s .. 500 VOperating TemperatureM Metal TO-99 .. 55 to +125 CP Plastic DIP and U SO-8 .. 40 to +85 CStorage TemperatureM Package .. 65 to +150 CP Plastic DIP and U SO-8 .. 55 to +125 CLead Temperature (soldering, 10s) .. +300 COutput Short Circuit to common .. ContinuousINA117 SBOS154A4 TYPICAL PERFORMANCE CURVESAt TA = +25 C, VS = 15V, unless otherwise Common-Mode Voltage RANGEvs POSITIVE POWER-SUPPLY VOLTAGEP ositive Power-Supply Voltage (V)510152040035030025020015010050 Positive Common-Mode Range (V)TA = +25 C TA = 55 CTA = +125 C VS = 5V to 20 VMax Rating = 200 VNEGATIVE Common-Mode Voltage RANGEvs NEGATIVE POWER-SUPPLY VOLTAGEN egative Power-Supply Voltage (V) 5 10 15 20 400 350 300 250 200 150 100 50 Negative Common-Mode Range (V)
8 TA = +25 CTA = 55 C to +125 C+VS = +5V to +20 VMax Rating = 200 VPOWER-SUPPLY REJECTION vs FREQUENCYF requency (Hz)1101001k10k100908070605040 Power-Supply Rejection (dB)V+V Common-Mode REJECTION vs FREQUENCYF requency (Hz)201001k10k100k2M100908070605040 Common-Mode Rejection (dB)INA117AM, SM, P, KUINA117 BMINA117 SBOS154A5 TYPICAL PERFORMANCE CURVES (Cont.)At TA = +25 C, VS = 15V, unless otherwise SIGNAL STEP RESPONSECL = 1000pFSMALL SIGNAL STEP RESPONSECL = 0 LARGE SIGNAL STEP RESPONSEINA117 SBOS154A6 APPLICATION INFORMATIONF igure 1 shows the basic connections required for with noisy or high -impedance power-supply linesmay require decoupling capacitors close to the device output Voltage is equal to the differential input volt-age between pins 2 and 3.
9 The common mode inputvoltage is circuitry connected to the compensation pin 8 can-cels the parasitic distributed capacitance between the feed-back resistor, R2, and the IC substrate. For specified dy-namic performance, pin 8 should be grounded or connectedthrough a F capacitor to an AC ground such as V+. Common-Mode REJECTIONC ommon-mode rejection (CMR) of the INA117 is depend-ent on the input resistor network, which is laser-trimmed foraccurate ratio matching. To maintain high CMR, it is impor-tant to have low source impedances driving the two 75 resistance in series with pin 2 or 3 will decrease CMRfrom 86dB to in series with the reference pins will also degradeCMR.
10 A 4 resistance in series with pin 1 or 5 will decreaseCMRR from 86dB to applications do not require trimming. Figures 2 and 3show optional circuits that may be used for trimming offsetvoltage and Common-Mode FUNCTIONMost applications use the INA117 as a simple unity-gaindifference amplifier. The transfer function is:VO = V3 V2V3 and V2 are the voltages at pins 3 and 1. Basic Power and Signal Connections.++380k 380k 380k 20k 4723815 15V+15V1 FTantalum1 FTantalum In = V2+In = V3VO = V3 V26R1R2R4R5R3380k 380k 380k 20k 4723815V V+V2V3VO = V3 V26100k 10 50k 15V+15V380k 380k 380k 20k 4723815V V+V2V3V = V VO 3 2610k 10mV100 100 V+V 100 A1/2 REF200100 A1/2 REF200 OPA27 Offset adjustment is regulated insensitive to power supply variations.
